PDB entry 1j05

View 1j05 on RCSB PDB site
Description: The crystal structure of anti-carcinoembryonic antigen monoclonal antibody T84.66 Fv fragment
Class: Immune system
Keywords: Immunoglobulin, Immune system
Deposited on 2002-11-01, released 2003-12-16
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.19
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: anti-CEA mAb T84.66, light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1j05a_
  • Chain 'B':
    Compound: anti-CEA mAb T84.66, heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1j05b_
  • Chain 'H':
    Compound: anti-CEA mAb T84.66, heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1j05h_
  • Chain 'L':
    Compound: anti-CEA mAb T84.66, light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1j05l_
  • Heterogens: PO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j05A (A:)
    divltqspaslavslgqratmscragesvdifgvgflhwyqqkpgqppklliyrasnles
    gipvrfsgtgsrtdftliidpveaddvatyycqqtnedpytfgggtkleik
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j05B (B:)
    evqlqqsgaelvepgasvklsctasgfnikdtymhwvkqrpeqglewigridpangnsky
    vpkfqgkatitadtssntaylqltsltsedtavyycapfgyyvsdyamaywgqgtsvtvs
    s
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j05H (H:)
    evqlqqsgaelvepgasvklsctasgfnikdtymhwvkqrpeqglewigridpangnsky
    vpkfqgkatitadtssntaylqltsltsedtavyycapfgyyvsdyamaywgqgtsvtvs
    s
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j05L (L:)
    divltqspaslavslgqratmscragesvdifgvgflhwyqqkpgqppklliyrasnles
    gipvrfsgtgsrtdftliidpveaddvatyycqqtnedpytfgggtkleik