PDB entry 1iz3

View 1iz3 on RCSB PDB site
Description: Dimeric structure of FIH (Factor inhibiting HIF)
Class: transcription
Keywords: double Beta-sheet helix, TRANSCRIPTION
Deposited on 2002-09-19, released 2003-06-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.23
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fih
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NWT6 (Start-348)
      • conflict (27)
      • modified residue (107)
      • modified residue (122)
      • modified residue (159)
      • modified residue (190)
      • modified residue (274)
      • modified residue (318)
      • modified residue (324)
      • modified residue (342)
    Domains in SCOPe 2.06: d1iz3a_
  • Heterogens: SO4

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1iz3A (A:)
    maataaeavtsgsgepreeagalgpawdesqlrsysfptrpiprlsqsdpraeelienee
    pvvltdtnlvypalkwdleylqenigngdfsvysasthkflyydekkmanfqnfkprsnr
    eemkfhefveklqdiqqrggeerlylqqtlndtvggkivmdflgfnwnwinkqqgkrgwg
    qltsnllligmegnvtpahydeqqnffaqikgykrcilfppdqfeclypypvhhpcdrqs
    qvdfdnpdyerfpnfqnvvgyetvvgpgdvlyipmywwhhiesllnggititvnfwykga
    ptpkrieyplkahqkvaimrniekmlgealgnpqevgpllntmikgryn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iz3A (A:)
    gsgepreeagalgpawdesqlrsysfptrpiprlsqsdpraeelieneepvvltdtnlvy
    palkwdleylqenigngdfsvysasthkflyydekkmanfqnfkprsnreemkfhefvek
    lqdiqqrggeerlylqqtlndtvggkivmdflgfnwnwinkqqgkrgwgqltsnllligm
    egnvtpahydeqqnffaqikgykrcilfppdqfeclypypvhhpcdrqsqvdfdnpdyer
    fpnfqnvvgyetvvgpgdvlyipmywwhhiesllnggititvnfwykgaptpkrieyplk
    ahqkvaimrniekmlgealgnpqevgpllntmikgryn