PDB entry 1iyx

View 1iyx on RCSB PDB site
Description:
Deposited on 2002-09-12, released 2003-07-29
The last revision prior to the SCOP 1.65 freeze date was dated 2003-07-29, with a file datestamp of 2003-07-29.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.175
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1iyxa1, d1iyxa2
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1iyxb1, d1iyxb2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1iyxA (A:)
    msiitdvyareildsrgnptievevytesgafgrgmvpsgastgeyeavelrdgdkaryg
    gkgvtkavdnvnniiaeaiigydvrdqmaidkamialdgtpnkgklganailgvsiavar
    aaadylevplyhylggfntkvlptpmmniinggshadnsidfqefmimpvgaptfkealr
    mgaevfhalaailksrglatsvgdeggfapnlgsneegfeviieaiekagyvpgkdvvla
    mdaassefydkekgvyvladsgegekttdemikfyeelvskypiisiedgldendwdgfk
    kltdvlgdkvqlvgddlfvtntqklsegiekgiansilikvnqigtltetfeaiemakea
    gytavvshrsgetedstisdiavatnagqiktgslsrtdriakynqllriedqlgevaey
    kglksfynlkaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iyxA (A:)
    siitdvyareildsrgnptievevytesgafgrgmvpsgastgeyeavelrdgdkarygg
    kgvtkavdnvnniiaeaiigydvrdqmaidkamialdgtpnkgklganailgvsiavara
    aadylevplyhylggfntkvlptpmmniinggshadnsidfqefmimpvgaptfkealrm
    gaevfhalaailksrglatsvgdeggfapnlgsneegfeviieaiekagyvpgkdvvlam
    daassefydkekgvyvladsgegekttdemikfyeelvskypiisiedgldendwdgfkk
    ltdvlgdkvqlvgddlfvtntqklsegiekgiansilikvnqigtltetfeaiemakeag
    ytavvshrsgetedstisdiavatnagqiktgslsrtdriakynqllriedqlgevaeyk
    glksfynlkaa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1iyxB (B:)
    msiitdvyareildsrgnptievevytesgafgrgmvpsgastgeyeavelrdgdkaryg
    gkgvtkavdnvnniiaeaiigydvrdqmaidkamialdgtpnkgklganailgvsiavar
    aaadylevplyhylggfntkvlptpmmniinggshadnsidfqefmimpvgaptfkealr
    mgaevfhalaailksrglatsvgdeggfapnlgsneegfeviieaiekagyvpgkdvvla
    mdaassefydkekgvyvladsgegekttdemikfyeelvskypiisiedgldendwdgfk
    kltdvlgdkvqlvgddlfvtntqklsegiekgiansilikvnqigtltetfeaiemakea
    gytavvshrsgetedstisdiavatnagqiktgslsrtdriakynqllriedqlgevaey
    kglksfynlkaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iyxB (B:)
    siitdvyareildsrgnptievevytesgafgrgmvpsgastgeyeavelrdgdkarygg
    kgvtkavdnvnniiaeaiigydvrdqmaidkamialdgtpnkgklganailgvsiavara
    aadylevplyhylggfntkvlptpmmniinggshadnsidfqefmimpvgaptfkealrm
    gaevfhalaailksrglatsvgdeggfapnlgsneegfeviieaiekagyvpgkdvvlam
    daassefydkekgvyvladsgegekttdemikfyeelvskypiisiedgldendwdgfkk
    ltdvlgdkvqlvgddlfvtntqklsegiekgiansilikvnqigtltetfeaiemakeag
    ytavvshrsgetedstisdiavatnagqiktgslsrtdriakynqllriedqlgevaeyk
    glksfynlkaa