PDB entry 1iyx

View 1iyx on RCSB PDB site
Description: Crystal structure of enolase from Enterococcus hirae
Class: lyase
Keywords: ENOLASE family, LYASE
Deposited on 2002-09-12, released 2003-07-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.175
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: enolase
    Species: ENTEROCOCCUS HIRAE [TaxId:1354]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1iyxa1, d1iyxa2
  • Chain 'B':
    Compound: enolase
    Species: ENTEROCOCCUS HIRAE [TaxId:1354]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1iyxb1, d1iyxb2
  • Heterogens: MG, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1iyxA (A:)
    msiitdvyareildsrgnptievevytesgafgrgmvpsgastgeyeavelrdgdkaryg
    gkgvtkavdnvnniiaeaiigydvrdqmaidkamialdgtpnkgklganailgvsiavar
    aaadylevplyhylggfntkvlptpmmniinggshadnsidfqefmimpvgaptfkealr
    mgaevfhalaailksrglatsvgdeggfapnlgsneegfeviieaiekagyvpgkdvvla
    mdaassefydkekgvyvladsgegekttdemikfyeelvskypiisiedgldendwdgfk
    kltdvlgdkvqlvgddlfvtntqklsegiekgiansilikvnqigtltetfeaiemakea
    gytavvshrsgetedstisdiavatnagqiktgslsrtdriakynqllriedqlgevaey
    kglksfynlkaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iyxA (A:)
    siitdvyareildsrgnptievevytesgafgrgmvpsgastgeyeavelrdgdkarygg
    kgvtkavdnvnniiaeaiigydvrdqmaidkamialdgtpnkgklganailgvsiavara
    aadylevplyhylggfntkvlptpmmniinggshadnsidfqefmimpvgaptfkealrm
    gaevfhalaailksrglatsvgdeggfapnlgsneegfeviieaiekagyvpgkdvvlam
    daassefydkekgvyvladsgegekttdemikfyeelvskypiisiedgldendwdgfkk
    ltdvlgdkvqlvgddlfvtntqklsegiekgiansilikvnqigtltetfeaiemakeag
    ytavvshrsgetedstisdiavatnagqiktgslsrtdriakynqllriedqlgevaeyk
    glksfynlkaa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1iyxB (B:)
    msiitdvyareildsrgnptievevytesgafgrgmvpsgastgeyeavelrdgdkaryg
    gkgvtkavdnvnniiaeaiigydvrdqmaidkamialdgtpnkgklganailgvsiavar
    aaadylevplyhylggfntkvlptpmmniinggshadnsidfqefmimpvgaptfkealr
    mgaevfhalaailksrglatsvgdeggfapnlgsneegfeviieaiekagyvpgkdvvla
    mdaassefydkekgvyvladsgegekttdemikfyeelvskypiisiedgldendwdgfk
    kltdvlgdkvqlvgddlfvtntqklsegiekgiansilikvnqigtltetfeaiemakea
    gytavvshrsgetedstisdiavatnagqiktgslsrtdriakynqllriedqlgevaey
    kglksfynlkaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iyxB (B:)
    siitdvyareildsrgnptievevytesgafgrgmvpsgastgeyeavelrdgdkarygg
    kgvtkavdnvnniiaeaiigydvrdqmaidkamialdgtpnkgklganailgvsiavara
    aadylevplyhylggfntkvlptpmmniinggshadnsidfqefmimpvgaptfkealrm
    gaevfhalaailksrglatsvgdeggfapnlgsneegfeviieaiekagyvpgkdvvlam
    daassefydkekgvyvladsgegekttdemikfyeelvskypiisiedgldendwdgfkk
    ltdvlgdkvqlvgddlfvtntqklsegiekgiansilikvnqigtltetfeaiemakeag
    ytavvshrsgetedstisdiavatnagqiktgslsrtdriakynqllriedqlgevaeyk
    glksfynlkaa