PDB entry 1iyi

View 1iyi on RCSB PDB site
Description:
Deposited on 2002-08-26, released 2003-04-08
The last revision prior to the SCOP 1.69 freeze date was dated 2003-04-08, with a file datestamp of 2003-04-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.188
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.69: d1iyia1, d1iyia2
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.69: d1iyib1, d1iyib2
  • Chain 'C':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.69: d1iyic1, d1iyic2
  • Chain 'D':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.69: d1iyid1, d1iyid2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iyiA (A:)
    pnykltyfnmrgraeiiryifayldiqyedhrieqadwpeikstlpfgkipilevdgltl
    hqslaiaryltkntdlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnellt
    ynaphlmqdldtylggrewligmsvtwadfyweicsttllvfkpdlldnhprlvtlrkkv
    qaipavanwikrrpqtkl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iyiB (B:)
    pnykltyfnmrgraeiiryifayldiqyedhrieqadwpeikstlpfgkipilevdgltl
    hqslaiaryltkntdlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnellt
    ynaphlmqdldtylggrewligmsvtwadfyweicsttllvfkpdlldnhprlvtlrkkv
    qaipavanwikrrpqtkl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iyiC (C:)
    pnykltyfnmrgraeiiryifayldiqyedhrieqadwpeikstlpfgkipilevdgltl
    hqslaiaryltkntdlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnellt
    ynaphlmqdldtylggrewligmsvtwadfyweicsttllvfkpdlldnhprlvtlrkkv
    qaipavanwikrrpqtkl
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iyiD (D:)
    pnykltyfnmrgraeiiryifayldiqyedhrieqadwpeikstlpfgkipilevdgltl
    hqslaiaryltkntdlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnellt
    ynaphlmqdldtylggrewligmsvtwadfyweicsttllvfkpdlldnhprlvtlrkkv
    qaipavanwikrrpqtkl