PDB entry 1iyh

View 1iyh on RCSB PDB site
Description: Crystal structure of hematopoietic prostaglandin D synthase
Class: isomerase
Keywords: hematopoietic prostaglandin d synthase, pgds, gst, sigma-class gst, ligase, isomerase
Deposited on 2002-08-26, released 2003-04-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-04-16, with a file datestamp of 2014-04-11.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.205
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hematopoietic prostaglandin d synthase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O60760
      • conflict (142)
    Domains in SCOPe 2.07: d1iyha1, d1iyha2
  • Chain 'B':
    Compound: hematopoietic prostaglandin d synthase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O60760
      • conflict (142)
    Domains in SCOPe 2.07: d1iyhb1, d1iyhb2
  • Chain 'C':
    Compound: hematopoietic prostaglandin d synthase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O60760
      • conflict (142)
    Domains in SCOPe 2.07: d1iyhc1, d1iyhc2
  • Chain 'D':
    Compound: hematopoietic prostaglandin d synthase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O60760 (0-197)
      • conflict (142)
    Domains in SCOPe 2.07: d1iyhd1, d1iyhd2
  • Heterogens: MG, GSH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iyhA (A:)
    pnykltyfnmrgraeiiryifayldiqyedhrieqadwpeikstlpfgkipilevdgltl
    hqslaiaryltkntdlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnellt
    ynaphlmqdldtylggrewligmsvtwadfyweicsttllvfkpdlldnhprlvtlrkkv
    qaipavanwikrrpqtkl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iyhB (B:)
    pnykltyfnmrgraeiiryifayldiqyedhrieqadwpeikstlpfgkipilevdgltl
    hqslaiaryltkntdlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnellt
    ynaphlmqdldtylggrewligmsvtwadfyweicsttllvfkpdlldnhprlvtlrkkv
    qaipavanwikrrpqtkl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iyhC (C:)
    pnykltyfnmrgraeiiryifayldiqyedhrieqadwpeikstlpfgkipilevdgltl
    hqslaiaryltkntdlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnellt
    ynaphlmqdldtylggrewligmsvtwadfyweicsttllvfkpdlldnhprlvtlrkkv
    qaipavanwikrrpqtkl
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iyhD (D:)
    pnykltyfnmrgraeiiryifayldiqyedhrieqadwpeikstlpfgkipilevdgltl
    hqslaiaryltkntdlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnellt
    ynaphlmqdldtylggrewligmsvtwadfyweicsttllvfkpdlldnhprlvtlrkkv
    qaipavanwikrrpqtkl