PDB entry 1iyg

View 1iyg on RCSB PDB site
Description: Solution structure of RSGI RUH-001, a Fis1p-like and CGI-135 homologous domain from a mouse cDNA
Class: structural genomics, unknown function
Keywords: MOUSE cDNA, FIS1P, CGI-135, STRUCTURAL GENOMICS, Hypothetical protein, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2002-08-14, released 2003-02-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Hypothetical protein (2010003O14)
  Species: Mus musculus [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9CQ92 (7-126)
    • cloning artifact (0-6)
    • cloning artifact (127-132)
  Domains in SCOPe 2.08: d1iyga1, d1iyga2, d1iyga3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1iygA (A:)
  gssgssgmeavlnelvsvedlknferkfqseqaagsvskstqfeyawclvrskynedirr
  givlleellpkgskeeqrdyvfylavgnyrlkeyekalkyvrgllqtepqnnqakelerl
  idkamkksgpssg