PDB entry 1iwx

View 1iwx on RCSB PDB site
Description: Crystal Structure Analysis of Human lysozyme at 161K.
Class: hydrolase
Keywords: o-glycosyl, glycosydase
Deposited on 2002-06-03, released 2002-09-04
The last revision prior to the SCOP 1.73 freeze date was dated 2002-09-04, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.187
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lysozyme C
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1iwxa_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iwxA (A:)
    kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
    srywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
    vrqyvqgcgv