PDB entry 1iwa

View 1iwa on RCSB PDB site
Description: rubisco from galdieria partita
Class: lyase
Keywords: rubisco, photosynthesis, lyase
Deposited on 2002-04-30, released 2003-04-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.172
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit
    Species: Galdieria partita [TaxId:83374]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1iwaa1, d1iwaa2
  • Chain 'B':
    Compound: ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit
    Species: Galdieria partita [TaxId:83374]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1iwab_
  • Chain 'C':
    Compound: ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit
    Species: Galdieria partita [TaxId:83374]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1iwac1, d1iwac2
  • Chain 'D':
    Compound: ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit
    Species: Galdieria partita [TaxId:83374]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1iwad_
  • Chain 'E':
    Compound: ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit
    Species: Galdieria partita [TaxId:83374]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1iwae1, d1iwae2
  • Chain 'F':
    Compound: ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit
    Species: Galdieria partita [TaxId:83374]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1iwaf_
  • Chain 'G':
    Compound: ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit
    Species: Galdieria partita [TaxId:83374]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1iwag1, d1iwag2
  • Chain 'H':
    Compound: ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit
    Species: Galdieria partita [TaxId:83374]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1iwah_
  • Chain 'I':
    Compound: ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit
    Species: Galdieria partita [TaxId:83374]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1iwai1, d1iwai2
  • Chain 'J':
    Compound: ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit
    Species: Galdieria partita [TaxId:83374]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1iwaj_
  • Chain 'K':
    Compound: ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit
    Species: Galdieria partita [TaxId:83374]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1iwak1, d1iwak2
  • Chain 'L':
    Compound: ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit
    Species: Galdieria partita [TaxId:83374]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1iwal_
  • Chain 'M':
    Compound: ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit
    Species: Galdieria partita [TaxId:83374]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1iwam1, d1iwam2
  • Chain 'N':
    Compound: ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit
    Species: Galdieria partita [TaxId:83374]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1iwan_
  • Chain 'O':
    Compound: ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit
    Species: Galdieria partita [TaxId:83374]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1iwao1, d1iwao2
  • Chain 'P':
    Compound: ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit
    Species: Galdieria partita [TaxId:83374]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1iwap_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1iwaA (A:)
    msqsieeksvqertriknsryesgvipyakmgywnpdyqvkdtdvlalfrvtpqpgvdpi
    eaaaavagesstatwtvvwtdlltaadlyrakaykvdqvpnnpeqyfayiayeldlfeeg
    sianltasiignvfgfkavkalrledmrlplaylktfqgpatgvilererldkfgrpllg
    cttkpklglsgknygrvvyealkggldfvkddeninsqpfmrwrerylftmeavnkasaa
    tgevkghylnvtaatmeemyaranfakelgsviimidlvigytaiqtmakwardndmilh
    lhragnstysrqknhgmnfrvickwmrmagvdhihagtvvgklegdpiitrgfyktlllp
    klernlqeglffdmewaslrkvmpvasggihagqmhqlihylgedvvlqfgggtighpdg
    iqagatanrvaleamilarnenrdyltegpeilreaaktcgalrtaldlwkditfnytst
    dtsdfvetptani
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iwaA (A:)
    triknsryesgvipyakmgywnpdyqvkdtdvlalfrvtpqpgvdpieaaaavagessta
    twtvvwtdlltaadlyrakaykvdqvpnnpeqyfayiayeldlfeegsianltasiignv
    fgfkavkalrledmrlplaylktfqgpatgvilererldkfgrpllgcttkpklglsgkn
    ygrvvyealkggldfvkddeninsqpfmrwrerylftmeavnkasaatgevkghylnvta
    atmeemyaranfakelgsviimidlvigytaiqtmakwardndmilhlhragnstysrqk
    nhgmnfrvickwmrmagvdhihagtvvgklegdpiitrgfyktlllpklernlqeglffd
    mewaslrkvmpvasggihagqmhqlihylgedvvlqfgggtighpdgiqagatanrvale
    amilarnenrdyltegpeilreaaktcgalrtaldlwkditfnytstdtsdfv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iwaB (B:)
    mritqgtfsflpdltdeqikkqidymiskklaigieytndihprnayweiwglplfdvtd
    paavlfeinacrkarsnfyikvvgfssvrgiestiisfivnrpkhepgfnlmrqedksrs
    ikytihsyesykpedery
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1iwaC (C:)
    msqsieeksvqertriknsryesgvipyakmgywnpdyqvkdtdvlalfrvtpqpgvdpi
    eaaaavagesstatwtvvwtdlltaadlyrakaykvdqvpnnpeqyfayiayeldlfeeg
    sianltasiignvfgfkavkalrledmrlplaylktfqgpatgvilererldkfgrpllg
    cttkpklglsgknygrvvyealkggldfvkddeninsqpfmrwrerylftmeavnkasaa
    tgevkghylnvtaatmeemyaranfakelgsviimidlvigytaiqtmakwardndmilh
    lhragnstysrqknhgmnfrvickwmrmagvdhihagtvvgklegdpiitrgfyktlllp
    klernlqeglffdmewaslrkvmpvasggihagqmhqlihylgedvvlqfgggtighpdg
    iqagatanrvaleamilarnenrdyltegpeilreaaktcgalrtaldlwkditfnytst
    dtsdfvetptani
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iwaC (C:)
    triknsryesgvipyakmgywnpdyqvkdtdvlalfrvtpqpgvdpieaaaavagessta
    twtvvwtdlltaadlyrakaykvdqvpnnpeqyfayiayeldlfeegsianltasiignv
    fgfkavkalrledmrlplaylktfqgpatgvilererldkfgrpllgcttkpklglsgkn
    ygrvvyealkggldfvkddeninsqpfmrwrerylftmeavnkasaatgevkghylnvta
    atmeemyaranfakelgsviimidlvigytaiqtmakwardndmilhlhragnstysrqk
    nhgmnfrvickwmrmagvdhihagtvvgklegdpiitrgfyktlllpklernlqeglffd
    mewaslrkvmpvasggihagqmhqlihylgedvvlqfgggtighpdgiqagatanrvale
    amilarnenrdyltegpeilreaaktcgalrtaldlwkditfnytstdtsdfv
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iwaD (D:)
    mritqgtfsflpdltdeqikkqidymiskklaigieytndihprnayweiwglplfdvtd
    paavlfeinacrkarsnfyikvvgfssvrgiestiisfivnrpkhepgfnlmrqedksrs
    ikytihsyesykpedery
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1iwaE (E:)
    msqsieeksvqertriknsryesgvipyakmgywnpdyqvkdtdvlalfrvtpqpgvdpi
    eaaaavagesstatwtvvwtdlltaadlyrakaykvdqvpnnpeqyfayiayeldlfeeg
    sianltasiignvfgfkavkalrledmrlplaylktfqgpatgvilererldkfgrpllg
    cttkpklglsgknygrvvyealkggldfvkddeninsqpfmrwrerylftmeavnkasaa
    tgevkghylnvtaatmeemyaranfakelgsviimidlvigytaiqtmakwardndmilh
    lhragnstysrqknhgmnfrvickwmrmagvdhihagtvvgklegdpiitrgfyktlllp
    klernlqeglffdmewaslrkvmpvasggihagqmhqlihylgedvvlqfgggtighpdg
    iqagatanrvaleamilarnenrdyltegpeilreaaktcgalrtaldlwkditfnytst
    dtsdfvetptani
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iwaE (E:)
    triknsryesgvipyakmgywnpdyqvkdtdvlalfrvtpqpgvdpieaaaavagessta
    twtvvwtdlltaadlyrakaykvdqvpnnpeqyfayiayeldlfeegsianltasiignv
    fgfkavkalrledmrlplaylktfqgpatgvilererldkfgrpllgcttkpklglsgkn
    ygrvvyealkggldfvkddeninsqpfmrwrerylftmeavnkasaatgevkghylnvta
    atmeemyaranfakelgsviimidlvigytaiqtmakwardndmilhlhragnstysrqk
    nhgmnfrvickwmrmagvdhihagtvvgklegdpiitrgfyktlllpklernlqeglffd
    mewaslrkvmpvasggihagqmhqlihylgedvvlqfgggtighpdgiqagatanrvale
    amilarnenrdyltegpeilreaaktcgalrtaldlwkditfnytstdtsdfv
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iwaF (F:)
    mritqgtfsflpdltdeqikkqidymiskklaigieytndihprnayweiwglplfdvtd
    paavlfeinacrkarsnfyikvvgfssvrgiestiisfivnrpkhepgfnlmrqedksrs
    ikytihsyesykpedery
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1iwaG (G:)
    msqsieeksvqertriknsryesgvipyakmgywnpdyqvkdtdvlalfrvtpqpgvdpi
    eaaaavagesstatwtvvwtdlltaadlyrakaykvdqvpnnpeqyfayiayeldlfeeg
    sianltasiignvfgfkavkalrledmrlplaylktfqgpatgvilererldkfgrpllg
    cttkpklglsgknygrvvyealkggldfvkddeninsqpfmrwrerylftmeavnkasaa
    tgevkghylnvtaatmeemyaranfakelgsviimidlvigytaiqtmakwardndmilh
    lhragnstysrqknhgmnfrvickwmrmagvdhihagtvvgklegdpiitrgfyktlllp
    klernlqeglffdmewaslrkvmpvasggihagqmhqlihylgedvvlqfgggtighpdg
    iqagatanrvaleamilarnenrdyltegpeilreaaktcgalrtaldlwkditfnytst
    dtsdfvetptani
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iwaG (G:)
    triknsryesgvipyakmgywnpdyqvkdtdvlalfrvtpqpgvdpieaaaavagessta
    twtvvwtdlltaadlyrakaykvdqvpnnpeqyfayiayeldlfeegsianltasiignv
    fgfkavkalrledmrlplaylktfqgpatgvilererldkfgrpllgcttkpklglsgkn
    ygrvvyealkggldfvkddeninsqpfmrwrerylftmeavnkasaatgevkghylnvta
    atmeemyaranfakelgsviimidlvigytaiqtmakwardndmilhlhragnstysrqk
    nhgmnfrvickwmrmagvdhihagtvvgklegdpiitrgfyktlllpklernlqeglffd
    mewaslrkvmpvasggihagqmhqlihylgedvvlqfgggtighpdgiqagatanrvale
    amilarnenrdyltegpeilreaaktcgalrtaldlwkditfnytstdtsdfv
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iwaH (H:)
    mritqgtfsflpdltdeqikkqidymiskklaigieytndihprnayweiwglplfdvtd
    paavlfeinacrkarsnfyikvvgfssvrgiestiisfivnrpkhepgfnlmrqedksrs
    ikytihsyesykpedery
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1iwaI (I:)
    msqsieeksvqertriknsryesgvipyakmgywnpdyqvkdtdvlalfrvtpqpgvdpi
    eaaaavagesstatwtvvwtdlltaadlyrakaykvdqvpnnpeqyfayiayeldlfeeg
    sianltasiignvfgfkavkalrledmrlplaylktfqgpatgvilererldkfgrpllg
    cttkpklglsgknygrvvyealkggldfvkddeninsqpfmrwrerylftmeavnkasaa
    tgevkghylnvtaatmeemyaranfakelgsviimidlvigytaiqtmakwardndmilh
    lhragnstysrqknhgmnfrvickwmrmagvdhihagtvvgklegdpiitrgfyktlllp
    klernlqeglffdmewaslrkvmpvasggihagqmhqlihylgedvvlqfgggtighpdg
    iqagatanrvaleamilarnenrdyltegpeilreaaktcgalrtaldlwkditfnytst
    dtsdfvetptani
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iwaI (I:)
    triknsryesgvipyakmgywnpdyqvkdtdvlalfrvtpqpgvdpieaaaavagessta
    twtvvwtdlltaadlyrakaykvdqvpnnpeqyfayiayeldlfeegsianltasiignv
    fgfkavkalrledmrlplaylktfqgpatgvilererldkfgrpllgcttkpklglsgkn
    ygrvvyealkggldfvkddeninsqpfmrwrerylftmeavnkasaatgevkghylnvta
    atmeemyaranfakelgsviimidlvigytaiqtmakwardndmilhlhragnstysrqk
    nhgmnfrvickwmrmagvdhihagtvvgklegdpiitrgfyktlllpklernlqeglffd
    mewaslrkvmpvasggihagqmhqlihylgedvvlqfgggtighpdgiqagatanrvale
    amilarnenrdyltegpeilreaaktcgalrtaldlwkditfnytstdtsdfv
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iwaJ (J:)
    mritqgtfsflpdltdeqikkqidymiskklaigieytndihprnayweiwglplfdvtd
    paavlfeinacrkarsnfyikvvgfssvrgiestiisfivnrpkhepgfnlmrqedksrs
    ikytihsyesykpedery
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1iwaK (K:)
    msqsieeksvqertriknsryesgvipyakmgywnpdyqvkdtdvlalfrvtpqpgvdpi
    eaaaavagesstatwtvvwtdlltaadlyrakaykvdqvpnnpeqyfayiayeldlfeeg
    sianltasiignvfgfkavkalrledmrlplaylktfqgpatgvilererldkfgrpllg
    cttkpklglsgknygrvvyealkggldfvkddeninsqpfmrwrerylftmeavnkasaa
    tgevkghylnvtaatmeemyaranfakelgsviimidlvigytaiqtmakwardndmilh
    lhragnstysrqknhgmnfrvickwmrmagvdhihagtvvgklegdpiitrgfyktlllp
    klernlqeglffdmewaslrkvmpvasggihagqmhqlihylgedvvlqfgggtighpdg
    iqagatanrvaleamilarnenrdyltegpeilreaaktcgalrtaldlwkditfnytst
    dtsdfvetptani
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iwaK (K:)
    triknsryesgvipyakmgywnpdyqvkdtdvlalfrvtpqpgvdpieaaaavagessta
    twtvvwtdlltaadlyrakaykvdqvpnnpeqyfayiayeldlfeegsianltasiignv
    fgfkavkalrledmrlplaylktfqgpatgvilererldkfgrpllgcttkpklglsgkn
    ygrvvyealkggldfvkddeninsqpfmrwrerylftmeavnkasaatgevkghylnvta
    atmeemyaranfakelgsviimidlvigytaiqtmakwardndmilhlhragnstysrqk
    nhgmnfrvickwmrmagvdhihagtvvgklegdpiitrgfyktlllpklernlqeglffd
    mewaslrkvmpvasggihagqmhqlihylgedvvlqfgggtighpdgiqagatanrvale
    amilarnenrdyltegpeilreaaktcgalrtaldlwkditfnytstdtsdfv
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iwaL (L:)
    mritqgtfsflpdltdeqikkqidymiskklaigieytndihprnayweiwglplfdvtd
    paavlfeinacrkarsnfyikvvgfssvrgiestiisfivnrpkhepgfnlmrqedksrs
    ikytihsyesykpedery
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1iwaM (M:)
    msqsieeksvqertriknsryesgvipyakmgywnpdyqvkdtdvlalfrvtpqpgvdpi
    eaaaavagesstatwtvvwtdlltaadlyrakaykvdqvpnnpeqyfayiayeldlfeeg
    sianltasiignvfgfkavkalrledmrlplaylktfqgpatgvilererldkfgrpllg
    cttkpklglsgknygrvvyealkggldfvkddeninsqpfmrwrerylftmeavnkasaa
    tgevkghylnvtaatmeemyaranfakelgsviimidlvigytaiqtmakwardndmilh
    lhragnstysrqknhgmnfrvickwmrmagvdhihagtvvgklegdpiitrgfyktlllp
    klernlqeglffdmewaslrkvmpvasggihagqmhqlihylgedvvlqfgggtighpdg
    iqagatanrvaleamilarnenrdyltegpeilreaaktcgalrtaldlwkditfnytst
    dtsdfvetptani
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iwaM (M:)
    triknsryesgvipyakmgywnpdyqvkdtdvlalfrvtpqpgvdpieaaaavagessta
    twtvvwtdlltaadlyrakaykvdqvpnnpeqyfayiayeldlfeegsianltasiignv
    fgfkavkalrledmrlplaylktfqgpatgvilererldkfgrpllgcttkpklglsgkn
    ygrvvyealkggldfvkddeninsqpfmrwrerylftmeavnkasaatgevkghylnvta
    atmeemyaranfakelgsviimidlvigytaiqtmakwardndmilhlhragnstysrqk
    nhgmnfrvickwmrmagvdhihagtvvgklegdpiitrgfyktlllpklernlqeglffd
    mewaslrkvmpvasggihagqmhqlihylgedvvlqfgggtighpdgiqagatanrvale
    amilarnenrdyltegpeilreaaktcgalrtaldlwkditfnytstdtsdfv
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iwaN (N:)
    mritqgtfsflpdltdeqikkqidymiskklaigieytndihprnayweiwglplfdvtd
    paavlfeinacrkarsnfyikvvgfssvrgiestiisfivnrpkhepgfnlmrqedksrs
    ikytihsyesykpedery
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >1iwaO (O:)
    msqsieeksvqertriknsryesgvipyakmgywnpdyqvkdtdvlalfrvtpqpgvdpi
    eaaaavagesstatwtvvwtdlltaadlyrakaykvdqvpnnpeqyfayiayeldlfeeg
    sianltasiignvfgfkavkalrledmrlplaylktfqgpatgvilererldkfgrpllg
    cttkpklglsgknygrvvyealkggldfvkddeninsqpfmrwrerylftmeavnkasaa
    tgevkghylnvtaatmeemyaranfakelgsviimidlvigytaiqtmakwardndmilh
    lhragnstysrqknhgmnfrvickwmrmagvdhihagtvvgklegdpiitrgfyktlllp
    klernlqeglffdmewaslrkvmpvasggihagqmhqlihylgedvvlqfgggtighpdg
    iqagatanrvaleamilarnenrdyltegpeilreaaktcgalrtaldlwkditfnytst
    dtsdfvetptani
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iwaO (O:)
    triknsryesgvipyakmgywnpdyqvkdtdvlalfrvtpqpgvdpieaaaavagessta
    twtvvwtdlltaadlyrakaykvdqvpnnpeqyfayiayeldlfeegsianltasiignv
    fgfkavkalrledmrlplaylktfqgpatgvilererldkfgrpllgcttkpklglsgkn
    ygrvvyealkggldfvkddeninsqpfmrwrerylftmeavnkasaatgevkghylnvta
    atmeemyaranfakelgsviimidlvigytaiqtmakwardndmilhlhragnstysrqk
    nhgmnfrvickwmrmagvdhihagtvvgklegdpiitrgfyktlllpklernlqeglffd
    mewaslrkvmpvasggihagqmhqlihylgedvvlqfgggtighpdgiqagatanrvale
    amilarnenrdyltegpeilreaaktcgalrtaldlwkditfnytstdtsdfv
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iwaP (P:)
    mritqgtfsflpdltdeqikkqidymiskklaigieytndihprnayweiwglplfdvtd
    paavlfeinacrkarsnfyikvvgfssvrgiestiisfivnrpkhepgfnlmrqedksrs
    ikytihsyesykpedery