PDB entry 1iw7

View 1iw7 on RCSB PDB site
Description: Crystal structure of the RNA polymerase holoenzyme from Thermus thermophilus at 2.6A resolution
Deposited on 2002-04-22, released 2002-06-26
The last revision prior to the SCOP 1.65 freeze date was dated 2002-06-26, with a file datestamp of 2002-06-26.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.228
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1iw7A (A:)
    mldsklkapvftvrtqgreygefvleplergfgvtlgnplrrillssipgtavtsvyied
    vlhefstipgvkedvveiilnlkelvvrflnpslqtvtlllkaegpkevkardflpvadv
    eimnpdlhiatleeggrlnmevrvdrgvgyvpaekhgikdrinaipvdavfspvrrvafq
    vedtrlgqrtdldkltlriwtdgsvtplealnqaveilrehltyfsnpqaaavaapeeak
    epeappeqeeeldlpleelglstrvlhslkeegiesvrallalnlkdlknipgigersle
    eikealekkgftlke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iw7A (A:)
    mldsklkapvftvrtqgreygefvleplergfgvtlgnplrrillssipgtavtsvyied
    vlhefstipgvkedvveiilnlkelvvrflnpslqtvtlllkaegpkevkardflpvadv
    eimnpdlhiatleeggrlnmevrvdrgvgyvpaekhgikdrinaipvdavfspvrrvafq
    vedtrlgqrtdldkltlriwtdgsvtplealnqaveilrehltyfsnpq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1iw7B (B:)
    mldsklkapvftvrtqgreygefvleplergfgvtlgnplrrillssipgtavtsvyied
    vlhefstipgvkedvveiilnlkelvvrflnpslqtvtlllkaegpkevkardflpvadv
    eimnpdlhiatleeggrlnmevrvdrgvgyvpaekhgikdrinaipvdavfspvrrvafq
    vedtrlgqrtdldkltlriwtdgsvtplealnqaveilrehltyfsnpqaaavaapeeak
    epeappeqeeeldlpleelglstrvlhslkeegiesvrallalnlkdlknipgigersle
    eikealekkgftlke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iw7B (B:)
    mldsklkapvftvrtqgreygefvleplergfgvtlgnplrrillssipgtavtsvyied
    vlhefstipgvkedvveiilnlkelvvrflnpslqtvtlllkaegpkevkardflpvadv
    eimnpdlhiatleeggrlnmevrvdrgvgyvpaekhgikdrinaipvdavfspvrrvafq
    vedtrlgqrtdldkltlriwtdgsvtplealnqaveilrehltyfsnpq
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iw7C (C:)
    meikrfgrireviplpplteiqvesyrralqadvppekrenvgiqaafretfpieeedkg
    kgglvldfleyrlgeppfpqdecrekdltyqaplyarlqlihkdtglikedevflghipl
    mtedgsfiingadrvivsqihrspgvyftpdparpgryiasiiplpkrgpwidlevepng
    vvsmkvnkrkfplvlllrvlgydqetlarelgaygelvqglmdesvfamrpeealirlft
    llrpgdppkrdkavayvygliadprrydlgeagrykaeeklgirlsgrtlarfedgefkd
    evflptlrylfaltagvpghevddidhlgnrrirtvgelmtdqfrvglarlargvrerml
    mgsedsltpaklvnsrpleaaireffsrsqlsqfkdetnplsslrhkrrisalgpggltr
    eragfdvrdvhrthygricpvetpeganiglitslaayarvdelgfirtpyrrvvggvvt
    devvymtateedrytiaqantplegnriaaervvarrkgepvivspeevefmdvspkqvf
    svntnlipflehddanralmgsnmqtqavpliraqapvvmtgleervvrdslaalyaeed
    gevakvdgnrivvryedgrlveyplrrfyrsnqgtaldqrprvvvgqrvrkgdlladgpa
    sengflalgqnvlvaimpfdgynfedaiviseellkrdfytsihieryeieardtklgpe
    ritrdiphlseaalrdldeegvvrigaevkpgdilvgrtsfkgeseptpeerllrsifge
    kardvkdtslrvppgeggivvrtvrlrrgdpgvelkpgvrevvrvyvaqkrklqvgdkla
    nrhgnkgvvakilpvedmphlpdgtpvdvilnplgvpsrmnlgqilethlglagyflgqr
    yispifdgakepeikellaqafevyfgkrkgegfgvdkrevevlrraeklglvtpgktpe
    eqlkelflqgkvvlydgrtgepiegpivvgqmfimklyhmvedkmharstgpyslitqqp
    lggkaqfggqrfgemevwaleaygaahtlqemltlksddiegrnaayeaiikgedvpeps
    vpesfrvlvkelqalaldvqtldekdnpvdifeglaskr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1iw7D (D:)
    mkkevrkvrialaspekirswsygevekpetinyrtlkperdglfderifgpikdyecac
    gkykrqrfegkvcercgvevtksivrryrmghielatpaahiwfvkdvpskigtlldlsa
    teleqvlyfskyivldpkgailngvpvekrqlltdeeyrelrygkqetyplppgvdalvk
    dgeevvkgqelapgvvsrldgvalyrfprrvrveyvkkeraglrlplaawvekeaykpge
    ilaelpepylfraeeegvvelkeleegaflvlrredepvatyflpvgmtplvvhgeivek
    gqplaeakgllrmprqvraaqveaeeegetvyltlflewtepkdyrvqphmnvvvpegar
    veagdkivaaidpeeeviaeaegvvhlhepasilvvkarvypfeddvevstgdrvapgdv
    ladggkvksdvygrvevdlvrnvvrvvesydidarmgaeaiqqllkeldlealekellee
    mkhpsrarrakarkrlevvrafldsgnrpewmileavpvlppdlrpmvqvdggrfatsdl
    ndlyrrlinrnnrlkkllaqgapeiiirnekrmlqeavdalldngrrgapvtnpgsdrpl
    rsltdilsgkqgrfrqnllgkrvdysgrsvivvgpqlklhqcglpkrmalelfkpfllkk
    meekgiapnvkaarrmlerqrdikdevwdaleevihgkvvllnraptlhrlgiqafqpvl
    vegqsiqlhplvceafnadfdgdqmavhvplssfaqaeariqmlsahnllspasgeplak
    psrdiilglyyitqvrkekkgaglefatpeealaahergevalnapikvagretsvgrlk
    yvfanpdeallavahgivdlqdvvtvrymgkrletspgrilfarivaeavedekvaweli
    qldvpqeknslkdlvyqaflrlgmektarlldalkyygftfsttsgitigiddavipeek
    kqyleeadrkllqieqayemgfltdrerydqilqlwtettekvtqavfknfeenypfnpl
    yvmaqsgargnpqqirqlcglrglmqkpsgetfevpvrssfregltvleyfisshgarkg
    gadtalrtadsgyltrklvdvtheivvreadcgttnyisvplfqpdevtrslrlrkradi
    eaglygrvlarevevlgvrleegrylsmddvhllikaaeageiqevpvrspltcqtrygv
    cqkcygydlsmarpvsigeavgivaaqsigepgtqltmrtfhtggvagaaditqglprvi
    elfearrpkakaviseidgvvrieeteeklsvfvesegfskeyklpkearllvkdgdyve
    agqpltrgaidphqlleakgpeaverylveeiqkvyraqgvklhdkhieivvrqmmkyve
    vtdpgdsrllegqvlekwdvealnerliaegktpvawkpllmgvtksalstkswlsaasf
    qntthvlteaaiagkkdeliglkenvilgrlipagtgsdfvrftqvvdqktlkaieeark
    eaveakerpaarrgvkreqpgkqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iw7D (D:)
    kkevrkvrialaspekirswsygevekpetinyrtlkperdglfderifgpikdyecacg
    kykrqrfegkvcercgvevtksivrryrmghielatpaahiwfvkdvpskigtlldlsat
    eleqvlyfskyivldpkgailngvpvekrqlltdeeyrelrygkqetyplppgvdalvkd
    geevvkgqelapgvvsrldgvalyrfprrvrveyvkkeraglrlplaawvekeaykpgei
    laelpepylfgdkivaaidpeeeviaeaegvvhlhepasilvvkarvypfeddvevstgd
    rvapgdvladggkvksdvygrvevdlvrnvvrvvesydidarmgaeaiqqllkeldleal
    ekelleemkhpsrarrakarkrlevvrafldsgnrpewmileavpvlppdlrpmvqvdgg
    rfatsdlndlyrrlinrnnrlkkllaqgapeiiirnekrmlqeavdalldngrrgapvtn
    pgsdrplrsltdilsgkqgrfrqnllgkrvdysgrsvivvgpqlklhqcglpkrmalelf
    kpfllkkmeekgiapnvkaarrmlerqrdikdevwdaleevihgkvvllnraptlhrlgi
    qafqpvlvegqsiqlhplvceafnadfdgdqmavhvplssfaqaeariqmlsahnllspa
    sgeplakpsrdiilglyyitqvrkekkgaglefatpeealaahergevalnapikvagre
    tsvgrlkyvfanpdeallavahgivdlqdvvtvrymgkrletspgrilfarivaeavede
    kvaweliqldvpqeknslkdlvyqaflrlgmektarlldalkyygftfsttsgitigidd
    avipeekkqyleeadrkllqieqayemgfltdrerydqilqlwtettekvtqavfknfee
    nypfnplyvmaqsgargnpqqirqlcglrglmqkpsgetfevpvrssfregltvleyfis
    shgarkggadtalrtadsgyltrklvdvtheivvreadcgttnyisvplfqpdevtrslr
    lrkradieaglygrvlarevevlgvrleegrylsmddvhllikaaeageiqevpvrsplt
    cqtrygvcqkcygydlsmarpvsigeavgivaaqsigepgtqltmrtfhtggvagaadit
    qglprvielfearrpkakaviseidgvvrieeteeklsvfvesegfskeyklpkearllv
    kdgdyveagqpltrgaidphqlleakgpeaverylveeiqkvyraqgvklhdkhieivvr
    qmmkyvevtdpgdsrllegqvlekwdvealnerliaegktpvawkpllmgvtksalstks
    wlsaasfqntthvlteaaiagkkdeliglkenvilgrlipagtgsdfvrftqvvdqktlk
    aieearkeavea
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1iw7E (E:)
    maepgidklfgmvdskyrltvvvakraqqllrhgfkntvlepeerpkmqtleglfddpna
    etwamkelltgrlvfgenlvpedrlqkemeriypgeree
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iw7E (E:)
    aepgidklfgmvdskyrltvvvakraqqllrhgfkntvlepeerpkmqtleglfddpnae
    twamkelltgrlvfgenlvpedrlqkemeriypge
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1iw7F (F:)
    mkkskrknaqaqeaqetevlvqeeaeelpefpegepdpdledpdlaleddlldlpeegeg
    ldleeeeedlpipkistsdpvrqylheigqvplltleeevelarkveegmeaikklseit
    gldpdlirevvrakilgsarvrhipglketldpktveeidqklkslpkehkrylhiareg
    eaarqhlieanlrlvvsiakkytgrglsfldliqegnqgliravekfeykrrfkfstyat
    wwirqainraiadqartiripvhmvetinklsrtarqlqqelgreptyeeiaeamgpgwd
    akrveetlkiaqepvsletpigdekdsfygdfipdehlpspvdaatqsllseelekalsk
    lsereamvlklrkglidgrehtleevgaffgvtrerirqienkalrklkyhesrtrklrd
    fld
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iw7F (F:)
    kistsdpvrqylheigqvplltleeevelarkveegmeaikklseitgldpdlirevvra
    kilgsarvrhipglketldpktveeidqklkslpkehkrylhiaregeaarqhlieanlr
    lvvsiakkytgrglsfldliqegnqgliravekfeykrrfkfstyatwwirqainraiad
    qartiripvhmvetinklsrtarqlqqelgreptyeeiaeamgpgwdakrveetlkiaqe
    pvsletpigdekdsfygdfipdehlpspvdaatqsllseelekalsklsereamvlklrk
    glidgeevgaffgvtrerirqienkalrklkyhesrtrklrdfld
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1iw7K (K:)
    mldsklkapvftvrtqgreygefvleplergfgvtlgnplrrillssipgtavtsvyied
    vlhefstipgvkedvveiilnlkelvvrflnpslqtvtlllkaegpkevkardflpvadv
    eimnpdlhiatleeggrlnmevrvdrgvgyvpaekhgikdrinaipvdavfspvrrvafq
    vedtrlgqrtdldkltlriwtdgsvtplealnqaveilrehltyfsnpqaaavaapeeak
    epeappeqeeeldlpleelglstrvlhslkeegiesvrallalnlkdlknipgigersle
    eikealekkgftlke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iw7K (K:)
    mldsklkapvftvrtqgreygefvleplergfgvtlgnplrrillssipgtavtsvyied
    vlhefstipgvkedvveiilnlkelvvrflnpslqtvtlllkaegpkevkardflpvadv
    eimnpdlhiatleeggrlnmevrvdrgvgyvpaekhgikdrinaipvdavfspvrrvafq
    vedtrlgqrtdldkltlriwtdgsvtplealnqaveilrehltyfsnpq
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1iw7L (L:)
    mldsklkapvftvrtqgreygefvleplergfgvtlgnplrrillssipgtavtsvyied
    vlhefstipgvkedvveiilnlkelvvrflnpslqtvtlllkaegpkevkardflpvadv
    eimnpdlhiatleeggrlnmevrvdrgvgyvpaekhgikdrinaipvdavfspvrrvafq
    vedtrlgqrtdldkltlriwtdgsvtplealnqaveilrehltyfsnpqaaavaapeeak
    epeappeqeeeldlpleelglstrvlhslkeegiesvrallalnlkdlknipgigersle
    eikealekkgftlke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iw7L (L:)
    mldsklkapvftvrtqgreygefvleplergfgvtlgnplrrillssipgtavtsvyied
    vlhefstipgvkedvveiilnlkelvvrflnpslqtvtlllkaegpkevkardflpvadv
    eimnpdlhiatleeggrlnmevrvdrgvgyvpaekhgikdrinaipvdavfspvrrvafq
    vedtrlgqrtdldkltlriwtdgsvtplealnqaveilrehltyfsnpq
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iw7M (M:)
    meikrfgrireviplpplteiqvesyrralqadvppekrenvgiqaafretfpieeedkg
    kgglvldfleyrlgeppfpqdecrekdltyqaplyarlqlihkdtglikedevflghipl
    mtedgsfiingadrvivsqihrspgvyftpdparpgryiasiiplpkrgpwidlevepng
    vvsmkvnkrkfplvlllrvlgydqetlarelgaygelvqglmdesvfamrpeealirlft
    llrpgdppkrdkavayvygliadprrydlgeagrykaeeklgirlsgrtlarfedgefkd
    evflptlrylfaltagvpghevddidhlgnrrirtvgelmtdqfrvglarlargvrerml
    mgsedsltpaklvnsrpleaaireffsrsqlsqfkdetnplsslrhkrrisalgpggltr
    eragfdvrdvhrthygricpvetpeganiglitslaayarvdelgfirtpyrrvvggvvt
    devvymtateedrytiaqantplegnriaaervvarrkgepvivspeevefmdvspkqvf
    svntnlipflehddanralmgsnmqtqavpliraqapvvmtgleervvrdslaalyaeed
    gevakvdgnrivvryedgrlveyplrrfyrsnqgtaldqrprvvvgqrvrkgdlladgpa
    sengflalgqnvlvaimpfdgynfedaiviseellkrdfytsihieryeieardtklgpe
    ritrdiphlseaalrdldeegvvrigaevkpgdilvgrtsfkgeseptpeerllrsifge
    kardvkdtslrvppgeggivvrtvrlrrgdpgvelkpgvrevvrvyvaqkrklqvgdkla
    nrhgnkgvvakilpvedmphlpdgtpvdvilnplgvpsrmnlgqilethlglagyflgqr
    yispifdgakepeikellaqafevyfgkrkgegfgvdkrevevlrraeklglvtpgktpe
    eqlkelflqgkvvlydgrtgepiegpivvgqmfimklyhmvedkmharstgpyslitqqp
    lggkaqfggqrfgemevwaleaygaahtlqemltlksddiegrnaayeaiikgedvpeps
    vpesfrvlvkelqalaldvqtldekdnpvdifeglaskr
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >1iw7N (N:)
    mkkevrkvrialaspekirswsygevekpetinyrtlkperdglfderifgpikdyecac
    gkykrqrfegkvcercgvevtksivrryrmghielatpaahiwfvkdvpskigtlldlsa
    teleqvlyfskyivldpkgailngvpvekrqlltdeeyrelrygkqetyplppgvdalvk
    dgeevvkgqelapgvvsrldgvalyrfprrvrveyvkkeraglrlplaawvekeaykpge
    ilaelpepylfraeeegvvelkeleegaflvlrredepvatyflpvgmtplvvhgeivek
    gqplaeakgllrmprqvraaqveaeeegetvyltlflewtepkdyrvqphmnvvvpegar
    veagdkivaaidpeeeviaeaegvvhlhepasilvvkarvypfeddvevstgdrvapgdv
    ladggkvksdvygrvevdlvrnvvrvvesydidarmgaeaiqqllkeldlealekellee
    mkhpsrarrakarkrlevvrafldsgnrpewmileavpvlppdlrpmvqvdggrfatsdl
    ndlyrrlinrnnrlkkllaqgapeiiirnekrmlqeavdalldngrrgapvtnpgsdrpl
    rsltdilsgkqgrfrqnllgkrvdysgrsvivvgpqlklhqcglpkrmalelfkpfllkk
    meekgiapnvkaarrmlerqrdikdevwdaleevihgkvvllnraptlhrlgiqafqpvl
    vegqsiqlhplvceafnadfdgdqmavhvplssfaqaeariqmlsahnllspasgeplak
    psrdiilglyyitqvrkekkgaglefatpeealaahergevalnapikvagretsvgrlk
    yvfanpdeallavahgivdlqdvvtvrymgkrletspgrilfarivaeavedekvaweli
    qldvpqeknslkdlvyqaflrlgmektarlldalkyygftfsttsgitigiddavipeek
    kqyleeadrkllqieqayemgfltdrerydqilqlwtettekvtqavfknfeenypfnpl
    yvmaqsgargnpqqirqlcglrglmqkpsgetfevpvrssfregltvleyfisshgarkg
    gadtalrtadsgyltrklvdvtheivvreadcgttnyisvplfqpdevtrslrlrkradi
    eaglygrvlarevevlgvrleegrylsmddvhllikaaeageiqevpvrspltcqtrygv
    cqkcygydlsmarpvsigeavgivaaqsigepgtqltmrtfhtggvagaaditqglprvi
    elfearrpkakaviseidgvvrieeteeklsvfvesegfskeyklpkearllvkdgdyve
    agqpltrgaidphqlleakgpeaverylveeiqkvyraqgvklhdkhieivvrqmmkyve
    vtdpgdsrllegqvlekwdvealnerliaegktpvawkpllmgvtksalstkswlsaasf
    qntthvlteaaiagkkdeliglkenvilgrlipagtgsdfvrftqvvdqktlkaieeark
    eaveakerpaarrgvkreqpgkqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iw7N (N:)
    kkevrkvrialaspekirswsygevekpetinyrtlkperdglfderifgpikdyecacg
    kykrqrfegkvcercgvevtksivrryrmghielatpaahiwfvkdvpskigtlldlsat
    eleqvlyfskyivldpkgailngvpvekrqlltdeeyrelrygkqetyplppgvdalvkd
    geevvkgqelapgvvsrldgvalyrfprrvrveyvkkeraglrlplaawvekeaykpgei
    laelpepylfgdkivaaidpeeeviaeaegvvhlhepasilvvkarvypfeddvevstgd
    rvapgdvladggkvksdvygrvevdlvrnvvrvvesydidarmgaeaiqqllkeldleal
    ekelleemkhpsrarrakarkrlevvrafldsgnrpewmileavpvlppdlrpmvqvdgg
    rfatsdlndlyrrlinrnnrlkkllaqgapeiiirnekrmlqeavdalldngrrgapvtn
    pgsdrplrsltdilsgkqgrfrqnllgkrvdysgrsvivvgpqlklhqcglpkrmalelf
    kpfllkkmeekgiapnvkaarrmlerqrdikdevwdaleevihgkvvllnraptlhrlgi
    qafqpvlvegqsiqlhplvceafnadfdgdqmavhvplssfaqaeariqmlsahnllspa
    sgeplakpsrdiilglyyitqvrkekkgaglefatpeealaahergevalnapikvagre
    tsvgrlkyvfanpdeallavahgivdlqdvvtvrymgkrletspgrilfarivaeavede
    kvaweliqldvpqeknslkdlvyqaflrlgmektarlldalkyygftfsttsgitigidd
    avipeekkqyleeadrkllqieqayemgfltdrerydqilqlwtettekvtqavfknfee
    nypfnplyvmaqsgargnpqqirqlcglrglmqkpsgetfevpvrssfregltvleyfis
    shgarkggadtalrtadsgyltrklvdvtheivvreadcgttnyisvplfqpdevtrslr
    lrkradieaglygrvlarevevlgvrleegrylsmddvhllikaaeageiqevpvrsplt
    cqtrygvcqkcygydlsmarpvsigeavgivaaqsigepgtqltmrtfhtggvagaadit
    qglprvielfearrpkakaviseidgvvrieeteeklsvfvesegfskeyklpkearllv
    kdgdyveagqpltrgaidphqlleakgpeaverylveeiqkvyraqgvklhdkhieivvr
    qmmkyvevtdpgdsrllegqvlekwdvealnerliaegktpvawkpllmgvtksalstks
    wlsaasfqntthvlteaaiagkkdeliglkenvilgrlipagtgsdfvrftqvvdqktlk
    aieearkeavea
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >1iw7O (O:)
    maepgidklfgmvdskyrltvvvakraqqllrhgfkntvlepeerpkmqtleglfddpna
    etwamkelltgrlvfgenlvpedrlqkemeriypgeree
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iw7O (O:)
    aepgidklfgmvdskyrltvvvakraqqllrhgfkntvlepeerpkmqtleglfddpnae
    twamkelltgrlvfgenlvpedrlqkemeriypge
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >1iw7P (P:)
    mkkskrknaqaqeaqetevlvqeeaeelpefpegepdpdledpdlaleddlldlpeegeg
    ldleeeeedlpipkistsdpvrqylheigqvplltleeevelarkveegmeaikklseit
    gldpdlirevvrakilgsarvrhipglketldpktveeidqklkslpkehkrylhiareg
    eaarqhlieanlrlvvsiakkytgrglsfldliqegnqgliravekfeykrrfkfstyat
    wwirqainraiadqartiripvhmvetinklsrtarqlqqelgreptyeeiaeamgpgwd
    akrveetlkiaqepvsletpigdekdsfygdfipdehlpspvdaatqsllseelekalsk
    lsereamvlklrkglidgrehtleevgaffgvtrerirqienkalrklkyhesrtrklrd
    fld
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iw7P (P:)
    kistsdpvrqylheigqvplltleeevelarkveegmeaikklseitgldpdlirevvra
    kilgsarvrhipglketldpktveeidqklkslpkehkrylhiaregeaarqhlieanlr
    lvvsiakkytgrglsfldliqegnqgliravekfeykrrfkfstyatwwirqainraiad
    qartiripvhmvetinklsrtarqlqqelgreptyeeiaeamgpgwdakrveetlkiaqe
    pvsletpigdekdsfygdfipdehlpspvdaatqsllseelekalsklsereamvlklrk
    glidgeevgaffgvtrerirqienkalrklkyhesrtrklrdfld