PDB entry 1iw6

View 1iw6 on RCSB PDB site
Description: crystal structure of the ground state of bacteriorhodopsin
Deposited on 2002-04-22, released 2002-12-11
The last revision prior to the SCOP 1.63 freeze date was dated 2002-12-11, with a file datestamp of 2002-12-11.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.251
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1iw6a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1iw6A (A:)
tgrpewiwlalgtalmglgtlyflvkgmgvsdpdakkfyaittlvpaiaftmylsmllgy
gltmvpfggeqnpiywaryadwlfttplllldlallvdadqgtilalvgadgimigtglv
galtkvysyrfvwwaistaamlyilyvlffgftskaesmrpevastfkvlrnvtvvlwsa
ypvvwligsegagivplnietllfmvldvsakvgfglillrsraifg