PDB entry 1ivl

View 1ivl on RCSB PDB site
Description: the de novo design of an antibody combining site: crystallographic analysis of the vl domain confirms the structural model
Class: immunoglobulin
Keywords: immunoglobulin
Deposited on 1994-05-04, released 1994-08-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-02-05, with a file datestamp of 2014-01-31.
Experiment type: XRAY
Resolution: 2.17 Å
R-factor: 0.175
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: igg-kappa m29b fv (light chain)
  Species: Mus musculus [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • GB AAA38741 (0-106)
    • conflict (2)
    • conflict (20)
    • conflict (31)
    • conflict (33)
    • conflict (82-84)
    • conflict (90-92)
    • conflict (95)
  Domains in SCOPe 2.08: d1ivla_
• Chain 'B':
  Compound: igg-kappa m29b fv (light chain)
  Species: Mus musculus [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • GB AAA38741 (0-106)
    • conflict (2)
    • conflict (20)
    • conflict (31)
    • conflict (33)
    • conflict (82-84)
    • conflict (90-92)
    • conflict (95)
  Domains in SCOPe 2.08: d1ivlb_
• Heterogens: IPA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ivlA (A:)
  dieltqspatlsvtpgnsvsiscrasqsignrlfwyqqkshesprllikyasqsisgips
  rfsgsgsgtdftlsinsvetedlavyfcqqvsewpftfgggtkleik
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ivlB (B:)
  dieltqspatlsvtpgnsvsiscrasqsignrlfwyqqkshesprllikyasqsisgips
  rfsgsgsgtdftlsinsvetedlavyfcqqvsewpftfgggtkleik