PDB entry 1iv0

View 1iv0 on RCSB PDB site
Description: Solution structure of the YqgF-family protein (N-terminal fragment)
Class: structural genomics, unknown function
Keywords: hypothetical protein, RNaseH-like, YqgF, STRUCTURAL GENOMICS, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2002-03-08, released 2003-10-07
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1iv0a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iv0A (A:)
    mrvgaldvgeariglavgeegvplasgrgylvrktleedvealldfvrreglgklvvglp
    lrtdlkesaqagkvlplvealrargvevelwderfttk