PDB entry 1iuz

View 1iuz on RCSB PDB site
Description: plastocyanin
Deposited on 1996-10-06, released 1997-08-20
The last revision prior to the SCOP 1.55 freeze date was dated 1997-08-20, with a file datestamp of 1997-08-20.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.176
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1iuz__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1iuz_ (-)
aqivklggddgslafvpskisvaageaiefvnnagfphnivfdedavpagvdadaisydd
ylnskgetvvrklstpgvygvycephagagmkmtitvq