PDB entry 1iu7

View 1iu7 on RCSB PDB site
Description: holo form of copper-containing amine oxidase from arthrobacter globiformis
Class: oxidoreductase
Keywords: oxidoreductase, copper, amine oxidase, arthrobacter globiformis, quinone cofactor, tpq
Deposited on 2002-02-28, released 2003-02-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.209
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: amine oxidase
    Species: Arthrobacter globiformis [TaxId:1665]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P46881
      • modified residue (381)
    Domains in SCOPe 2.07: d1iu7a1, d1iu7a2, d1iu7a3
  • Chain 'B':
    Compound: amine oxidase
    Species: Arthrobacter globiformis [TaxId:1665]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P46881
      • modified residue (381)
    Domains in SCOPe 2.07: d1iu7b1, d1iu7b2, d1iu7b3
  • Heterogens: CU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1iu7A (A:)
    mtpstiqtaspfrlasageisevqgilrtagllgpekriaylgvldpargagseaedrrf
    rvfihdvsgarpqevtvsvtngtvisaveldtaatgelpvleeefevveqllatderwlk
    alaarnldvskvrvaplsagvfeyaeergrrilrglafvqdfpedsawahpvdglvayvd
    vvskevtrvidtgvfpvpaehgnytdpeltgplrttqkpisitqpegpsftvtggnhiew
    ekwsldvgfdvregvvlhniafrdgdrlrpiinrasiaemvvpygdpspirswqnyfdtg
    eylvgqyanslelgcdclgditylspvisdafgnpreirngicmheedwgilakhsdlws
    ginytrrnrrmvisffttignydygfywylyldgtiefeakatgvvftsafpeggsdnis
    qlapglgapfhqhifsarldmaidgftnrveeedvvrqtmgpgnergnafsrkrtvltre
    seavreadartgrtwiisnpesknrlnepvgyklhahnqptlladpgssiarraafatkd
    lwvtryadderyptgdfvnqhsggaglpsyiaqdrdidgqdivvwhtfglthfprvedwp
    impvdtvgfklrpegffdrspvldvpanpsqsgshchg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iu7A (A:)
    aspfrlasageisevqgilrtagllgpekriaylgvldpargagseaedrrfrvfihdvs
    garpqevtvsvtngtvisaveldtaatgelpvleeefevveqllatderwlkalaarnld
    vskvrvaplsagvfeyaeergrrilrglafvqdfpedsawahpvdglvayvdvvskevtr
    vidtgvfpvpaehgnytdpeltgplrttqkpisitqpegpsftvtggnhiewekwsldvg
    fdvregvvlhniafrdgdrlrpiinrasiaemvvpygdpspirswqnyfdtgeylvgqya
    nslelgcdclgditylspvisdafgnpreirngicmheedwgilakhsdlwsginytrrn
    rrmvisffttignydygfywylyldgtiefeakatgvvftsafpeggsdnisqlapglga
    pfhqhifsarldmaidgftnrveeedvvrqtmgpgnergnafsrkrtvltreseavread
    artgrtwiisnpesknrlnepvgyklhahnqptlladpgssiarraafatkdlwvtryad
    deryptgdfvnqhsggaglpsyiaqdrdidgqdivvwhtfglthfprvedwpimpvdtvg
    fklrpegffdrspvldvpan
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1iu7B (B:)
    mtpstiqtaspfrlasageisevqgilrtagllgpekriaylgvldpargagseaedrrf
    rvfihdvsgarpqevtvsvtngtvisaveldtaatgelpvleeefevveqllatderwlk
    alaarnldvskvrvaplsagvfeyaeergrrilrglafvqdfpedsawahpvdglvayvd
    vvskevtrvidtgvfpvpaehgnytdpeltgplrttqkpisitqpegpsftvtggnhiew
    ekwsldvgfdvregvvlhniafrdgdrlrpiinrasiaemvvpygdpspirswqnyfdtg
    eylvgqyanslelgcdclgditylspvisdafgnpreirngicmheedwgilakhsdlws
    ginytrrnrrmvisffttignydygfywylyldgtiefeakatgvvftsafpeggsdnis
    qlapglgapfhqhifsarldmaidgftnrveeedvvrqtmgpgnergnafsrkrtvltre
    seavreadartgrtwiisnpesknrlnepvgyklhahnqptlladpgssiarraafatkd
    lwvtryadderyptgdfvnqhsggaglpsyiaqdrdidgqdivvwhtfglthfprvedwp
    impvdtvgfklrpegffdrspvldvpanpsqsgshchg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iu7B (B:)
    aspfrlasageisevqgilrtagllgpekriaylgvldpargagseaedrrfrvfihdvs
    garpqevtvsvtngtvisaveldtaatgelpvleeefevveqllatderwlkalaarnld
    vskvrvaplsagvfeyaeergrrilrglafvqdfpedsawahpvdglvayvdvvskevtr
    vidtgvfpvpaehgnytdpeltgplrttqkpisitqpegpsftvtggnhiewekwsldvg
    fdvregvvlhniafrdgdrlrpiinrasiaemvvpygdpspirswqnyfdtgeylvgqya
    nslelgcdclgditylspvisdafgnpreirngicmheedwgilakhsdlwsginytrrn
    rrmvisffttignydygfywylyldgtiefeakatgvvftsafpeggsdnisqlapglga
    pfhqhifsarldmaidgftnrveeedvvrqtmgpgnergnafsrkrtvltreseavread
    artgrtwiisnpesknrlnepvgyklhahnqptlladpgssiarraafatkdlwvtryad
    deryptgdfvnqhsggaglpsyiaqdrdidgqdivvwhtfglthfprvedwpimpvdtvg
    fklrpegffdrspvldvpan