PDB entry 1iu6

View 1iu6 on RCSB PDB site
Description: Neutron Crystal Structure of the rubredoxin mutant from Pyrococcus Furiosus
Class: electron transport
Keywords: rubredoxin, mutant, hydrogen, hydration, thermostability
Deposited on 2002-02-27, released 2002-08-27
The last revision prior to the SCOP 1.73 freeze date was dated 2004-08-03, with a file datestamp of 2007-06-04.
Experiment type: NEUT
Resolution: 1.6 Å
R-factor: 0.201
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rubredoxin
    Species: Pyrococcus furiosus
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24297 (0-End)
      • engineered (2)
      • engineered (22)
      • engineered (31)
    Domains in SCOP 1.73: d1iu6a_
  • Heterogens: FE, DOD

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1iu6A (A:)
    akyvckicgyiydedagdpdngvspgtkfeeipddwvcpicgapksefekled
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iu6A (A:)
    akyvckicgyiydedagdpdngvspgtkfeeipddwvcpicgapksefekle