PDB entry 1iu6

View 1iu6 on RCSB PDB site
Description: Neutron Crystal Structure of the rubredoxin mutant from Pyrococcus Furiosus
Class: electron transport
Keywords: rubredoxin, mutant, hydrogen, hydration, thermostability, ELECTRON TRANSPORT
Deposited on 2002-02-27, released 2002-08-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: NEUT
Resolution: 1.6 Å
R-factor: 0.201
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rubredoxin
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24297 (0-End)
      • engineered (2)
      • engineered (22)
      • engineered (31)
    Domains in SCOPe 2.07: d1iu6a_
  • Heterogens: FE, DOD

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1iu6A (A:)
    akyvckicgyiydedagdpdngvspgtkfeeipddwvcpicgapksefekled
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iu6A (A:)
    akyvckicgyiydedagdpdngvspgtkfeeipddwvcpicgapksefekle