PDB entry 1itz

View 1itz on RCSB PDB site
Description: Maize Transketolase in complex with TPP
Deposited on 2002-02-15, released 2003-02-15
The last revision prior to the SCOP 1.65 freeze date was dated 2003-02-15, with a file datestamp of 2003-02-15.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.166
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1itzA (A:)
    gavetlqgkaatgelleksvntirflaidavekansghpglpmgcapmghvlydevmryn
    pknpywfnrdrfvlsaghgcmlqyallhlagydsvkeedlkqfrqwgsrtpghpenfetp
    gvevttgplgqgianavglalaekhlaarfnkpdseivdhytyvilgdgcqmegianeac
    slaghwglgkliafyddnhisidgdteiaftedvstrfealgwhtiwvkngntgyddira
    aikeakavtdkptlikvtttigfgspnkansysvhgsalgakeveatrqnlgwpydtffv
    pedvkshwsrhtpegaaleadwnakfaeyekkyaddaatlksiitgelptgwvdalpkyt
    pespgdatrnlsqqclnalanvvpgliggsadlassnmtllkmfgdfqkdtaeernvrfg
    vrehgmgaicngialhspgfvpycatffvftdymrgamrisalseagviyvmthdsiglg
    edgpthqpiehlvsframpnilmlrpadgnetagaykvavlnrkrpsilalsrqklphlp
    gtsiegvekggytisdnstgnkpdlivmgtgseleiaakaadelrkegktvrvvsfvswe
    lfdeqsdeykesvlpaavtarisieagstlgwqkyvgaqgkaigidkfgasapagtiyke
    ygitvesiiaaaksf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1itzA (A:)
    aatgelleksvntirflaidavekansghpglpmgcapmghvlydevmrynpknpywfnr
    drfvlsaghgcmlqyallhlagydsvkeedlkqfrqwgsrtpghpenfetpgvevttgpl
    gqgianavglalaekhlaarfnkpdseivdhytyvilgdgcqmegianeacslaghwglg
    kliafyddnhisidgdteiaftedvstrfealgwhtiwvkngntgyddiraaikeakavt
    dkptlikvtttigfgspnkansysvhgsalgakeveatrqnlgwpydtffvpedvkshws
    rhtpegaaleadwnakfaeyekkyaddaatlksiitgelptgwvdalpkytpespgdatr
    nlsqqclnalanvvpgliggsadlassnmtllkmfgdfqkdtaeernvrfgvrehgmgai
    cngialhspgfvpycatffvftdymrgamrisalseagviyvmthdsiglgedgpthqpi
    ehlvsframpnilmlrpadgnetagaykvavlnrkrpsilalsrqklphlpgtsiegvek
    ggytisdnstgnkpdlivmgtgseleiaakaadelrkegktvrvvsfvswelfdeqsdey
    kesvlpaavtarisieagstlgwqkyvgaqgkaigidkfgasapagtiykeygitvesii
    aaaksf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1itzB (B:)
    gavetlqgkaatgelleksvntirflaidavekansghpglpmgcapmghvlydevmryn
    pknpywfnrdrfvlsaghgcmlqyallhlagydsvkeedlkqfrqwgsrtpghpenfetp
    gvevttgplgqgianavglalaekhlaarfnkpdseivdhytyvilgdgcqmegianeac
    slaghwglgkliafyddnhisidgdteiaftedvstrfealgwhtiwvkngntgyddira
    aikeakavtdkptlikvtttigfgspnkansysvhgsalgakeveatrqnlgwpydtffv
    pedvkshwsrhtpegaaleadwnakfaeyekkyaddaatlksiitgelptgwvdalpkyt
    pespgdatrnlsqqclnalanvvpgliggsadlassnmtllkmfgdfqkdtaeernvrfg
    vrehgmgaicngialhspgfvpycatffvftdymrgamrisalseagviyvmthdsiglg
    edgpthqpiehlvsframpnilmlrpadgnetagaykvavlnrkrpsilalsrqklphlp
    gtsiegvekggytisdnstgnkpdlivmgtgseleiaakaadelrkegktvrvvsfvswe
    lfdeqsdeykesvlpaavtarisieagstlgwqkyvgaqgkaigidkfgasapagtiyke
    ygitvesiiaaaksf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1itzB (B:)
    aatgelleksvntirflaidavekansghpglpmgcapmghvlydevmrynpknpywfnr
    drfvlsaghgcmlqyallhlagydsvkeedlkqfrqwgsrtpghpenfetpgvevttgpl
    gqgianavglalaekhlaarfnkpdseivdhytyvilgdgcqmegianeacslaghwglg
    kliafyddnhisidgdteiaftedvstrfealgwhtiwvkngntgyddiraaikeakavt
    dkptlikvtttigfgspnkansysvhgsalgakeveatrqnlgwpydtffvpedvkshws
    rhtpegaaleadwnakfaeyekkyaddaatlksiitgelptgwvdalpkytpespgdatr
    nlsqqclnalanvvpgliggsadlassnmtllkmfgdfqkdtaeernvrfgvrehgmgai
    cngialhspgfvpycatffvftdymrgamrisalseagviyvmthdsiglgedgpthqpi
    ehlvsframpnilmlrpadgnetagaykvavlnrkrpsilalsrqklphlpgtsiegvek
    ggytisdnstgnkpdlivmgtgseleiaakaadelrkegktvrvvsfvswelfdeqsdey
    kesvlpaavtarisieagstlgwqkyvgaqgkaigidkfgasapagtiykeygitvesii
    aaaksf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1itzC (C:)
    gavetlqgkaatgelleksvntirflaidavekansghpglpmgcapmghvlydevmryn
    pknpywfnrdrfvlsaghgcmlqyallhlagydsvkeedlkqfrqwgsrtpghpenfetp
    gvevttgplgqgianavglalaekhlaarfnkpdseivdhytyvilgdgcqmegianeac
    slaghwglgkliafyddnhisidgdteiaftedvstrfealgwhtiwvkngntgyddira
    aikeakavtdkptlikvtttigfgspnkansysvhgsalgakeveatrqnlgwpydtffv
    pedvkshwsrhtpegaaleadwnakfaeyekkyaddaatlksiitgelptgwvdalpkyt
    pespgdatrnlsqqclnalanvvpgliggsadlassnmtllkmfgdfqkdtaeernvrfg
    vrehgmgaicngialhspgfvpycatffvftdymrgamrisalseagviyvmthdsiglg
    edgpthqpiehlvsframpnilmlrpadgnetagaykvavlnrkrpsilalsrqklphlp
    gtsiegvekggytisdnstgnkpdlivmgtgseleiaakaadelrkegktvrvvsfvswe
    lfdeqsdeykesvlpaavtarisieagstlgwqkyvgaqgkaigidkfgasapagtiyke
    ygitvesiiaaaksf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1itzC (C:)
    aatgelleksvntirflaidavekansghpglpmgcapmghvlydevmrynpknpywfnr
    drfvlsaghgcmlqyallhlagydsvkeedlkqfrqwgsrtpghpenfetpgvevttgpl
    gqgianavglalaekhlaarfnkpdseivdhytyvilgdgcqmegianeacslaghwglg
    kliafyddnhisidgdteiaftedvstrfealgwhtiwvkngntgyddiraaikeakavt
    dkptlikvtttigfgspnkansysvhgsalgakeveatrqnlgwpydtffvpedvkshws
    rhtpegaaleadwnakfaeyekkyaddaatlksiitgelptgwvdalpkytpespgdatr
    nlsqqclnalanvvpgliggsadlassnmtllkmfgdfqkdtaeernvrfgvrehgmgai
    cngialhspgfvpycatffvftdymrgamrisalseagviyvmthdsiglgedgpthqpi
    ehlvsframpnilmlrpadgnetagaykvavlnrkrpsilalsrqklphlpgtsiegvek
    ggytisdnstgnkpdlivmgtgseleiaakaadelrkegktvrvvsfvswelfdeqsdey
    kesvlpaavtarisieagstlgwqkyvgaqgkaigidkfgasapagtiykeygitvesii
    aaaksf