PDB entry 1itu

View 1itu on RCSB PDB site
Description: human renal dipeptidase complexed with cilastatin
Class: hydrolase
Keywords: dipeptidase, glycoprotein, membrane-bound, zinc protease beta-lactamase, cilastatin, complex (hydrolase/inhibitor)
Deposited on 2002-02-03, released 2002-08-28
The last revision prior to the SCOP 1.75 freeze date was dated 2002-08-28, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.185
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: renal dipeptidase
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1itua_
  • Chain 'B':
    Compound: renal dipeptidase
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1itub_
  • Heterogens: NAG, ZN, CIL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ituA (A:)
    dffrdeaerimrdspvidghndlpwqlldmfnnrlqderanlttlagthtnipklragfv
    ggqfwsvytpcdtqnkdavrrtleqmdvvhrmcrmypetflyvtssagirqafregkvas
    ligvegghsidsslgvlralyqlgmryltlthscntpwadnwlvdtgdsepqsqglspfg
    qrvvkelnrlgvlidlahvsvatmkatlqlsrapvifshssaysvcasrrnvpddvlrlv
    kqtdslvmvnfynnyisctnkanlsqvadhldhikevagaravgfggdfdgvprvpegle
    dvskypdliaellrrnwteaevkgaladnllrvfeaveqasnltqapeeepipldqlggs
    crthygyss
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ituB (B:)
    dffrdeaerimrdspvidghndlpwqlldmfnnrlqderanlttlagthtnipklragfv
    ggqfwsvytpcdtqnkdavrrtleqmdvvhrmcrmypetflyvtssagirqafregkvas
    ligvegghsidsslgvlralyqlgmryltlthscntpwadnwlvdtgdsepqsqglspfg
    qrvvkelnrlgvlidlahvsvatmkatlqlsrapvifshssaysvcasrrnvpddvlrlv
    kqtdslvmvnfynnyisctnkanlsqvadhldhikevagaravgfggdfdgvprvpegle
    dvskypdliaellrrnwteaevkgaladnllrvfeaveqasnltqapeeepipldqlggs
    crthygyss