PDB entry 1itq

View 1itq on RCSB PDB site
Description: human renal dipeptidase
Class: hydrolase
Keywords: dipeptidase, glycoprotein, membrane-bound, zinc protease beta-lactamase, cilastatin, complex (hydrolase-inhibitor), hydrolase
Deposited on 2002-02-02, released 2002-08-28
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.181
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: renal dipeptidase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1itqa_
  • Chain 'B':
    Compound: renal dipeptidase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1itqb_
  • Heterogens: NAG, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1itqA (A:)
    dffrdeaerimrdspvidghndlpwqlldmfnnrlqderanlttlagthtnipklragfv
    ggqfwsvytpcdtqnkdavrrtleqmdvvhrmcrmypetflyvtssagirqafregkvas
    ligvegghsidsslgvlralyqlgmryltlthscntpwadnwlvdtgdsepqsqglspfg
    qrvvkelnrlgvlidlahvsvatmkatlqlsrapvifshssaysvcasrrnvpddvlrlv
    kqtdslvmvnfynnyisctnkanlsqvadhldhikevagaravgfggdfdgvprvpegle
    dvskypdliaellrrnwteaevkgaladnllrvfeaveqasnltqapeeepipldqlggs
    crthygyss
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1itqB (B:)
    dffrdeaerimrdspvidghndlpwqlldmfnnrlqderanlttlagthtnipklragfv
    ggqfwsvytpcdtqnkdavrrtleqmdvvhrmcrmypetflyvtssagirqafregkvas
    ligvegghsidsslgvlralyqlgmryltlthscntpwadnwlvdtgdsepqsqglspfg
    qrvvkelnrlgvlidlahvsvatmkatlqlsrapvifshssaysvcasrrnvpddvlrlv
    kqtdslvmvnfynnyisctnkanlsqvadhldhikevagaravgfggdfdgvprvpegle
    dvskypdliaellrrnwteaevkgaladnllrvfeaveqasnltqapeeepipldqlggs
    crthygyss