PDB entry 1ise

View 1ise on RCSB PDB site
Description: Crystal structure of a mutant of ribosome recycling factor from Escherichia coli, Arg132Gly
Class: translation
Keywords: Translation
Deposited on 2001-11-30, released 2003-10-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.239
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribosome recycling factor
    Species: Escherichia coli [TaxId:562]
    Gene: frr
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A805 (Start-184)
      • engineered (131)
    Domains in SCOPe 2.06: d1isea_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1iseA (A:)
    misdirkdaevrmdkcveafktqiskirtgraspslldgivveyygtptplrqlasvtve
    dsrtlkinvfdrsmspavekaimasdlglnpnsagsdirvplpplteerrkdltkivrge
    aeqarvavrnvgrdandkvkallkdkeisedddrrsqddvqkltdaaikkieaaladkea
    elmqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iseA (A:)
    isdirkdaevrmdkcveafktqiskirtgraspslldgivveyygtptplrqlasvtved
    srtlkinvfdrsmspavekaimasdlglnpnsagsdirvplpplteerrkdltkivrgea
    eqarvavrnvgrdandkvkallkdkeisedddrrsqddvqkltdaaikkieaaladkeae
    lmqf