PDB entry 1ise

View 1ise on RCSB PDB site
Description: crystal structure of a mutant of ribosome recycling factor from escherichia coli, arg132gly
Deposited on 2001-11-30, released 2003-10-07
The last revision prior to the SCOP 1.69 freeze date was dated 2003-10-07, with a file datestamp of 2003-10-07.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.239
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1isea_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1iseA (A:)
    misdirkdaevrmdkcveafktqiskirtgraspslldgivveyygtptplrqlasvtve
    dsrtlkinvfdrsmspavekaimasdlglnpnsagsdirvplpplteerrkdltkivrge
    aeqarvavrnvgrdandkvkallkdkeisedddrrsqddvqkltdaaikkieaaladkea
    elmqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iseA (A:)
    isdirkdaevrmdkcveafktqiskirtgraspslldgivveyygtptplrqlasvtved
    srtlkinvfdrsmspavekaimasdlglnpnsagsdirvplpplteerrkdltkivrgea
    eqarvavrnvgrdandkvkallkdkeisedddrrsqddvqkltdaaikkieaaladkeae
    lmqf