PDB entry 1irw

View 1irw on RCSB PDB site
Description: cytochrome c isozyme 1, reduced, mutant with asn 52 replaced by ala and cys 102 replaced by thr
Deposited on 1996-06-27, released 1997-01-11
The last revision prior to the SCOP 1.63 freeze date was dated 1997-01-11, with a file datestamp of 1997-01-13.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.183
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.63: d1irw__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1irw_ (-)
  tefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdaaikk
  nvlwdennmseyltnpkkyipgtkmafgglkkekdrndlitylkkate