PDB entry 1irn

View 1irn on RCSB PDB site
Description: rubredoxin (zn-substituted) at 1.2 angstroms resolution
Class: electron transport
Keywords: electron transport
Deposited on 1995-12-13, released 1996-04-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.107
AEROSPACI score: 0.87 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rubredoxin
    Species: Clostridium pasteurianum [TaxId:1501]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1irna_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1irnA (A:)
    mkkytctvcgyiynpedgdpdngvnpgtdfkdipddwvcplcgvgkdqfeevee
    

    Sequence, based on observed residues (ATOM records): (download)
    >1irnA (A:)
    mkkytctvcgyiynpedgdpdngvnpgtdfkdipddwvcplcgvgkdqfeeve