PDB entry 1ir2

View 1ir2 on RCSB PDB site
Description: Crystal Structure of Activated Ribulose-1,5-bisphosphate Carboxylase/oxygenase (Rubisco) from Green alga, Chlamydomonas reinhardtii Complexed with 2-Carboxyarabinitol-1,5-bisphosphate (2-CABP)
Class: lyase
Keywords: N-methylmethionine, 4-hydroxyproline, S-methylcysteine, ALPHA/BETA BARREL
Deposited on 2001-09-03, released 2002-03-20
The last revision prior to the SCOP 1.73 freeze date was dated 2003-01-14, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.84 Å
R-factor: 0.152
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Compound: Small subunit of Rubisco
    Species: Chlamydomonas reinhardtii
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08475 (0-139)
      • modified residue (0)
    Domains in SCOP 1.73: d1ir21_
  • Chain '2':
    Compound: Small subunit of Rubisco
    Species: Chlamydomonas reinhardtii
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08475 (0-139)
      • modified residue (0)
    Domains in SCOP 1.73: d1ir22_
  • Chain '3':
    Compound: Small subunit of Rubisco
    Species: Chlamydomonas reinhardtii
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08475 (0-139)
      • modified residue (0)
    Domains in SCOP 1.73: d1ir23_
  • Chain '4':
    Compound: Small subunit of Rubisco
    Species: Chlamydomonas reinhardtii
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08475 (0-139)
      • modified residue (0)
    Domains in SCOP 1.73: d1ir24_
  • Chain '5':
    Compound: Small subunit of Rubisco
    Species: Chlamydomonas reinhardtii
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08475 (0-139)
      • modified residue (0)
    Domains in SCOP 1.73: d1ir25_
  • Chain '6':
    Compound: Small subunit of Rubisco
    Species: Chlamydomonas reinhardtii
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08475 (0-139)
      • modified residue (0)
    Domains in SCOP 1.73: d1ir26_
  • Chain '7':
    Compound: Small subunit of Rubisco
    Species: Chlamydomonas reinhardtii
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08475 (0-139)
      • modified residue (0)
    Domains in SCOP 1.73: d1ir27_
  • Chain '8':
    Compound: Small subunit of Rubisco
    Species: Chlamydomonas reinhardtii
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08475 (0-139)
      • modified residue (0)
    Domains in SCOP 1.73: d1ir28_
  • Chain 'A':
    Compound: Large subunit of Rubisco
    Species: Chlamydomonas reinhardtii
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00877 (Start-474)
      • see remark 999 (45)
      • modified residue (103)
      • modified residue (150)
      • modified residue (200)
      • modified residue (255)
      • modified residue (368)
    Domains in SCOP 1.73: d1ir2a1, d1ir2a2
  • Chain 'B':
    Compound: Large subunit of Rubisco
    Species: Chlamydomonas reinhardtii
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00877 (Start-474)
      • see remark 999 (45)
      • modified residue (103)
      • modified residue (150)
      • modified residue (200)
      • modified residue (255)
      • modified residue (368)
    Domains in SCOP 1.73: d1ir2b1, d1ir2b2
  • Chain 'C':
    Compound: Large subunit of Rubisco
    Species: Chlamydomonas reinhardtii
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00877 (Start-474)
      • see remark 999 (45)
      • modified residue (103)
      • modified residue (150)
      • modified residue (200)
      • modified residue (255)
      • modified residue (368)
    Domains in SCOP 1.73: d1ir2c1, d1ir2c2
  • Chain 'D':
    Compound: Large subunit of Rubisco
    Species: Chlamydomonas reinhardtii
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00877 (Start-474)
      • see remark 999 (45)
      • modified residue (103)
      • modified residue (150)
      • modified residue (200)
      • modified residue (255)
      • modified residue (368)
    Domains in SCOP 1.73: d1ir2d1, d1ir2d2
  • Chain 'E':
    Compound: Large subunit of Rubisco
    Species: Chlamydomonas reinhardtii
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00877 (Start-474)
      • see remark 999 (45)
      • modified residue (103)
      • modified residue (150)
      • modified residue (200)
      • modified residue (255)
      • modified residue (368)
    Domains in SCOP 1.73: d1ir2e1, d1ir2e2
  • Chain 'F':
    Compound: Large subunit of Rubisco
    Species: Chlamydomonas reinhardtii
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00877 (Start-474)
      • see remark 999 (45)
      • modified residue (103)
      • modified residue (150)
      • modified residue (200)
      • modified residue (255)
      • modified residue (368)
    Domains in SCOP 1.73: d1ir2f1, d1ir2f2
  • Chain 'G':
    Compound: Large subunit of Rubisco
    Species: Chlamydomonas reinhardtii
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00877 (Start-474)
      • see remark 999 (45)
      • modified residue (103)
      • modified residue (150)
      • modified residue (200)
      • modified residue (255)
      • modified residue (368)
    Domains in SCOP 1.73: d1ir2g1, d1ir2g2
  • Chain 'H':
    Compound: Large subunit of Rubisco
    Species: Chlamydomonas reinhardtii
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00877 (Start-474)
      • see remark 999 (45)
      • modified residue (103)
      • modified residue (150)
      • modified residue (200)
      • modified residue (255)
      • modified residue (368)
    Domains in SCOP 1.73: d1ir2h1, d1ir2h2
  • Chain 'I':
    Compound: Small subunit of Rubisco
    Species: Chlamydomonas reinhardtii
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08475 (0-139)
      • modified residue (0)
    Domains in SCOP 1.73: d1ir2i_
  • Chain 'J':
    Compound: Small subunit of Rubisco
    Species: Chlamydomonas reinhardtii
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08475 (0-139)
      • modified residue (0)
    Domains in SCOP 1.73: d1ir2j_
  • Chain 'K':
    Compound: Small subunit of Rubisco
    Species: Chlamydomonas reinhardtii
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08475 (0-139)
      • modified residue (0)
    Domains in SCOP 1.73: d1ir2k_
  • Chain 'L':
    Compound: Small subunit of Rubisco
    Species: Chlamydomonas reinhardtii
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08475 (0-139)
      • modified residue (0)
    Domains in SCOP 1.73: d1ir2l_
  • Chain 'M':
    Compound: Small subunit of Rubisco
    Species: Chlamydomonas reinhardtii
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08475 (0-139)
      • modified residue (0)
    Domains in SCOP 1.73: d1ir2m_
  • Chain 'N':
    Compound: Small subunit of Rubisco
    Species: Chlamydomonas reinhardtii
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08475 (0-139)
      • modified residue (0)
    Domains in SCOP 1.73: d1ir2n_
  • Chain 'O':
    Compound: Small subunit of Rubisco
    Species: Chlamydomonas reinhardtii
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08475 (0-139)
      • modified residue (0)
    Domains in SCOP 1.73: d1ir2o_
  • Chain 'P':
    Compound: Small subunit of Rubisco
    Species: Chlamydomonas reinhardtii
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08475 (0-139)
      • modified residue (0)
    Domains in SCOP 1.73: d1ir2p_
  • Chain 'S':
    Compound: Large subunit of Rubisco
    Species: Chlamydomonas reinhardtii
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00877 (Start-474)
      • see remark 999 (45)
      • modified residue (103)
      • modified residue (150)
      • modified residue (200)
      • modified residue (255)
      • modified residue (368)
    Domains in SCOP 1.73: d1ir2s1, d1ir2s2
  • Chain 'T':
    Compound: Large subunit of Rubisco
    Species: Chlamydomonas reinhardtii
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00877 (Start-474)
      • see remark 999 (45)
      • modified residue (103)
      • modified residue (150)
      • modified residue (200)
      • modified residue (255)
      • modified residue (368)
    Domains in SCOP 1.73: d1ir2t1, d1ir2t2
  • Chain 'U':
    Compound: Large subunit of Rubisco
    Species: Chlamydomonas reinhardtii
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00877 (Start-474)
      • see remark 999 (45)
      • modified residue (103)
      • modified residue (150)
      • modified residue (200)
      • modified residue (255)
      • modified residue (368)
    Domains in SCOP 1.73: d1ir2u1, d1ir2u2
  • Chain 'V':
    Compound: Large subunit of Rubisco
    Species: Chlamydomonas reinhardtii
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00877 (Start-474)
      • see remark 999 (45)
      • modified residue (103)
      • modified residue (150)
      • modified residue (200)
      • modified residue (255)
      • modified residue (368)
    Domains in SCOP 1.73: d1ir2v1, d1ir2v2
  • Chain 'W':
    Compound: Large subunit of Rubisco
    Species: Chlamydomonas reinhardtii
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00877 (Start-474)
      • see remark 999 (45)
      • modified residue (103)
      • modified residue (150)
      • modified residue (200)
      • modified residue (255)
      • modified residue (368)
    Domains in SCOP 1.73: d1ir2w1, d1ir2w2
  • Chain 'X':
    Compound: Large subunit of Rubisco
    Species: Chlamydomonas reinhardtii
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00877 (Start-474)
      • see remark 999 (45)
      • modified residue (103)
      • modified residue (150)
      • modified residue (200)
      • modified residue (255)
      • modified residue (368)
    Domains in SCOP 1.73: d1ir2x1, d1ir2x2
  • Chain 'Y':
    Compound: Large subunit of Rubisco
    Species: Chlamydomonas reinhardtii
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00877 (Start-474)
      • see remark 999 (45)
      • modified residue (103)
      • modified residue (150)
      • modified residue (200)
      • modified residue (255)
      • modified residue (368)
    Domains in SCOP 1.73: d1ir2y1, d1ir2y2
  • Chain 'Z':
    Compound: Large subunit of Rubisco
    Species: Chlamydomonas reinhardtii
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00877 (Start-474)
      • see remark 999 (45)
      • modified residue (103)
      • modified residue (150)
      • modified residue (200)
      • modified residue (255)
      • modified residue (368)
    Domains in SCOP 1.73: d1ir2z1, d1ir2z2
  • Heterogens: MG, CAP, GOL, HOH

PDB Chain Sequences:

  • Chain '1':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ir21 (1:)
    mmvwtpvnnkmfetfsylpplsdeqiaaqvdyivangwipclefaesdkayvsnesairf
    gsvsclyydnrywtmwklpmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimg
    flvqrpksardwqpankrsv
    

  • Chain '2':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ir22 (2:)
    mmvwtpvnnkmfetfsylpplsdeqiaaqvdyivangwipclefaesdkayvsnesairf
    gsvsclyydnrywtmwklpmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimg
    flvqrpksardwqpankrsv
    

  • Chain '3':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ir23 (3:)
    mmvwtpvnnkmfetfsylpplsdeqiaaqvdyivangwipclefaesdkayvsnesairf
    gsvsclyydnrywtmwklpmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimg
    flvqrpksardwqpankrsv
    

  • Chain '4':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ir24 (4:)
    mmvwtpvnnkmfetfsylpplsdeqiaaqvdyivangwipclefaesdkayvsnesairf
    gsvsclyydnrywtmwklpmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimg
    flvqrpksardwqpankrsv
    

  • Chain '5':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ir25 (5:)
    mmvwtpvnnkmfetfsylpplsdeqiaaqvdyivangwipclefaesdkayvsnesairf
    gsvsclyydnrywtmwklpmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimg
    flvqrpksardwqpankrsv
    

  • Chain '6':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ir26 (6:)
    mmvwtpvnnkmfetfsylpplsdeqiaaqvdyivangwipclefaesdkayvsnesairf
    gsvsclyydnrywtmwklpmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimg
    flvqrpksardwqpankrsv
    

  • Chain '7':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ir27 (7:)
    mmvwtpvnnkmfetfsylpplsdeqiaaqvdyivangwipclefaesdkayvsnesairf
    gsvsclyydnrywtmwklpmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimg
    flvqrpksardwqpankrsv
    

  • Chain '8':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ir28 (8:)
    mmvwtpvnnkmfetfsylpplsdeqiaaqvdyivangwipclefaesdkayvsnesairf
    gsvsclyydnrywtmwklpmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimg
    flvqrpksardwqpankrsv
    

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ir2A (A:)
    mvpqtetkagagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaae
    sstgtwttvwtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsi
    vgnvfgfkalralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklgl
    saknygravyeclrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghyl
    natagtceemmkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhav
    idrqrnhgihfrvlakalrmsggdhlhsgtvvgklegerevtlgfvdlmrddyvekdrsr
    giyftqdwcsmpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaan
    rvaleactqarnegrdlareggdvirsackwspelaaacevwkeikfefdtidkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ir2A (A:)
    kagagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtwt
    tvwtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfgf
    kalralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklglsaknygr
    avyeclrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghylnatagtc
    eemmkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhavidrqrnh
    gihfrvlakalrmsggdhlhsgtvvgklegerevtlgfvdlmrddyvekdrsrgiyftqd
    wcsmpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaanrvaleac
    tqarnegrdlareggdvirsackwspelaaacevwkeikfefdtidkl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ir2B (B:)
    mvpqtetkagagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaae
    sstgtwttvwtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsi
    vgnvfgfkalralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklgl
    saknygravyeclrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghyl
    natagtceemmkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhav
    idrqrnhgihfrvlakalrmsggdhlhsgtvvgklegerevtlgfvdlmrddyvekdrsr
    giyftqdwcsmpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaan
    rvaleactqarnegrdlareggdvirsackwspelaaacevwkeikfefdtidkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ir2B (B:)
    agagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtwtt
    vwtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfgfk
    alralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklglsaknygra
    vyeclrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghylnatagtce
    emmkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhavidrqrnhg
    ihfrvlakalrmsggdhlhsgtvvgklegerevtlgfvdlmrddyvekdrsrgiyftqdw
    csmpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaanrvaleact
    qarnegrdlareggdvirsackwspelaaacevwkeikfefdtidkl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ir2C (C:)
    mvpqtetkagagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaae
    sstgtwttvwtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsi
    vgnvfgfkalralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklgl
    saknygravyeclrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghyl
    natagtceemmkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhav
    idrqrnhgihfrvlakalrmsggdhlhsgtvvgklegerevtlgfvdlmrddyvekdrsr
    giyftqdwcsmpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaan
    rvaleactqarnegrdlareggdvirsackwspelaaacevwkeikfefdtidkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ir2C (C:)
    gagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtwttv
    wtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfgfka
    lralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklglsaknygrav
    yeclrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghylnatagtcee
    mmkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhavidrqrnhgi
    hfrvlakalrmsggdhlhsgtvvgklegerevtlgfvdlmrddyvekdrsrgiyftqdwc
    smpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaanrvaleactq
    arnegrdlareggdvirsackwspelaaacevwkeikfefdtidkl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ir2D (D:)
    mvpqtetkagagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaae
    sstgtwttvwtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsi
    vgnvfgfkalralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklgl
    saknygravyeclrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghyl
    natagtceemmkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhav
    idrqrnhgihfrvlakalrmsggdhlhsgtvvgklegerevtlgfvdlmrddyvekdrsr
    giyftqdwcsmpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaan
    rvaleactqarnegrdlareggdvirsackwspelaaacevwkeikfefdtidkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ir2D (D:)
    agagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtwtt
    vwtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfgfk
    alralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklglsaknygra
    vyeclrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghylnatagtce
    emmkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhavidrqrnhg
    ihfrvlakalrmsggdhlhsgtvvgklegerevtlgfvdlmrddyvekdrsrgiyftqdw
    csmpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaanrvaleact
    qarnegrdlareggdvirsackwspelaaacevwkeikfefdtidkl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1ir2E (E:)
    mvpqtetkagagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaae
    sstgtwttvwtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsi
    vgnvfgfkalralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklgl
    saknygravyeclrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghyl
    natagtceemmkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhav
    idrqrnhgihfrvlakalrmsggdhlhsgtvvgklegerevtlgfvdlmrddyvekdrsr
    giyftqdwcsmpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaan
    rvaleactqarnegrdlareggdvirsackwspelaaacevwkeikfefdtidkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ir2E (E:)
    agfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtwttvw
    tdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfgfkal
    ralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklglsaknygravy
    eclrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghylnatagtceem
    mkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhavidrqrnhgih
    frvlakalrmsggdhlhsgtvvgklegerevtlgfvdlmrddyvekdrsrgiyftqdwcs
    mpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaanrvaleactqa
    rnegrdlareggdvirsackwspelaaacevwkeikfefdtidkl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1ir2F (F:)
    mvpqtetkagagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaae
    sstgtwttvwtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsi
    vgnvfgfkalralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklgl
    saknygravyeclrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghyl
    natagtceemmkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhav
    idrqrnhgihfrvlakalrmsggdhlhsgtvvgklegerevtlgfvdlmrddyvekdrsr
    giyftqdwcsmpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaan
    rvaleactqarnegrdlareggdvirsackwspelaaacevwkeikfefdtidkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ir2F (F:)
    agfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtwttvw
    tdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfgfkal
    ralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklglsaknygravy
    eclrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghylnatagtceem
    mkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhavidrqrnhgih
    frvlakalrmsggdhlhsgtvvgklegerevtlgfvdlmrddyvekdrsrgiyftqdwcs
    mpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaanrvaleactqa
    rnegrdlareggdvirsackwspelaaacevwkeikfefdtidkl
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1ir2G (G:)
    mvpqtetkagagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaae
    sstgtwttvwtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsi
    vgnvfgfkalralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklgl
    saknygravyeclrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghyl
    natagtceemmkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhav
    idrqrnhgihfrvlakalrmsggdhlhsgtvvgklegerevtlgfvdlmrddyvekdrsr
    giyftqdwcsmpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaan
    rvaleactqarnegrdlareggdvirsackwspelaaacevwkeikfefdtidkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ir2G (G:)
    gagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtwttv
    wtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfgfka
    lralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklglsaknygrav
    yeclrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghylnatagtcee
    mmkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhavidrqrnhgi
    hfrvlakalrmsggdhlhsgtvvgklegerevtlgfvdlmrddyvekdrsrgiyftqdwc
    smpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaanrvaleactq
    arnegrdlareggdvirsackwspelaaacevwkeikfefdtidkl
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1ir2H (H:)
    mvpqtetkagagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaae
    sstgtwttvwtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsi
    vgnvfgfkalralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklgl
    saknygravyeclrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghyl
    natagtceemmkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhav
    idrqrnhgihfrvlakalrmsggdhlhsgtvvgklegerevtlgfvdlmrddyvekdrsr
    giyftqdwcsmpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaan
    rvaleactqarnegrdlareggdvirsackwspelaaacevwkeikfefdtidkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ir2H (H:)
    kagagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtwt
    tvwtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfgf
    kalralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklglsaknygr
    avyeclrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghylnatagtc
    eemmkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhavidrqrnh
    gihfrvlakalrmsggdhlhsgtvvgklegerevtlgfvdlmrddyvekdrsrgiyftqd
    wcsmpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaanrvaleac
    tqarnegrdlareggdvirsackwspelaaacevwkeikfefdtidkl
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ir2I (I:)
    mmvwtpvnnkmfetfsylpplsdeqiaaqvdyivangwipclefaesdkayvsnesairf
    gsvsclyydnrywtmwklpmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimg
    flvqrpksardwqpankrsv
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ir2J (J:)
    mmvwtpvnnkmfetfsylpplsdeqiaaqvdyivangwipclefaesdkayvsnesairf
    gsvsclyydnrywtmwklpmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimg
    flvqrpksardwqpankrsv
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ir2K (K:)
    mmvwtpvnnkmfetfsylpplsdeqiaaqvdyivangwipclefaesdkayvsnesairf
    gsvsclyydnrywtmwklpmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimg
    flvqrpksardwqpankrsv
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ir2L (L:)
    mmvwtpvnnkmfetfsylpplsdeqiaaqvdyivangwipclefaesdkayvsnesairf
    gsvsclyydnrywtmwklpmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimg
    flvqrpksardwqpankrsv
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ir2M (M:)
    mmvwtpvnnkmfetfsylpplsdeqiaaqvdyivangwipclefaesdkayvsnesairf
    gsvsclyydnrywtmwklpmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimg
    flvqrpksardwqpankrsv
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ir2N (N:)
    mmvwtpvnnkmfetfsylpplsdeqiaaqvdyivangwipclefaesdkayvsnesairf
    gsvsclyydnrywtmwklpmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimg
    flvqrpksardwqpankrsv
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ir2O (O:)
    mmvwtpvnnkmfetfsylpplsdeqiaaqvdyivangwipclefaesdkayvsnesairf
    gsvsclyydnrywtmwklpmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimg
    flvqrpksardwqpankrsv
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ir2P (P:)
    mmvwtpvnnkmfetfsylpplsdeqiaaqvdyivangwipclefaesdkayvsnesairf
    gsvsclyydnrywtmwklpmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimg
    flvqrpksardwqpankrsv
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >1ir2S (S:)
    mvpqtetkagagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaae
    sstgtwttvwtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsi
    vgnvfgfkalralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklgl
    saknygravyeclrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghyl
    natagtceemmkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhav
    idrqrnhgihfrvlakalrmsggdhlhsgtvvgklegerevtlgfvdlmrddyvekdrsr
    giyftqdwcsmpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaan
    rvaleactqarnegrdlareggdvirsackwspelaaacevwkeikfefdtidkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ir2S (S:)
    agfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtwttvw
    tdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfgfkal
    ralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklglsaknygravy
    eclrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghylnatagtceem
    mkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhavidrqrnhgih
    frvlakalrmsggdhlhsgtvvgklegerevtlgfvdlmrddyvekdrsrgiyftqdwcs
    mpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaanrvaleactqa
    rnegrdlareggdvirsackwspelaaacevwkeikfefdtidkl
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >1ir2T (T:)
    mvpqtetkagagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaae
    sstgtwttvwtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsi
    vgnvfgfkalralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklgl
    saknygravyeclrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghyl
    natagtceemmkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhav
    idrqrnhgihfrvlakalrmsggdhlhsgtvvgklegerevtlgfvdlmrddyvekdrsr
    giyftqdwcsmpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaan
    rvaleactqarnegrdlareggdvirsackwspelaaacevwkeikfefdtidkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ir2T (T:)
    gagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtwttv
    wtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfgfka
    lralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklglsaknygrav
    yeclrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghylnatagtcee
    mmkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhavidrqrnhgi
    hfrvlakalrmsggdhlhsgtvvgklegerevtlgfvdlmrddyvekdrsrgiyftqdwc
    smpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaanrvaleactq
    arnegrdlareggdvirsackwspelaaacevwkeikfefdtidkl
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >1ir2U (U:)
    mvpqtetkagagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaae
    sstgtwttvwtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsi
    vgnvfgfkalralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklgl
    saknygravyeclrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghyl
    natagtceemmkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhav
    idrqrnhgihfrvlakalrmsggdhlhsgtvvgklegerevtlgfvdlmrddyvekdrsr
    giyftqdwcsmpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaan
    rvaleactqarnegrdlareggdvirsackwspelaaacevwkeikfefdtidkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ir2U (U:)
    tkagagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtw
    ttvwtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfg
    fkalralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklglsaknyg
    ravyeclrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghylnatagt
    ceemmkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhavidrqrn
    hgihfrvlakalrmsggdhlhsgtvvgklegerevtlgfvdlmrddyvekdrsrgiyftq
    dwcsmpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaanrvalea
    ctqarnegrdlareggdvirsackwspelaaacevwkeikfefdtidkl
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >1ir2V (V:)
    mvpqtetkagagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaae
    sstgtwttvwtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsi
    vgnvfgfkalralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklgl
    saknygravyeclrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghyl
    natagtceemmkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhav
    idrqrnhgihfrvlakalrmsggdhlhsgtvvgklegerevtlgfvdlmrddyvekdrsr
    giyftqdwcsmpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaan
    rvaleactqarnegrdlareggdvirsackwspelaaacevwkeikfefdtidkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ir2V (V:)
    tkagagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtw
    ttvwtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfg
    fkalralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklglsaknyg
    ravyeclrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghylnatagt
    ceemmkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhavidrqrn
    hgihfrvlakalrmsggdhlhsgtvvgklegerevtlgfvdlmrddyvekdrsrgiyftq
    dwcsmpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaanrvalea
    ctqarnegrdlareggdvirsackwspelaaacevwkeikfefdtidkl
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >1ir2W (W:)
    mvpqtetkagagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaae
    sstgtwttvwtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsi
    vgnvfgfkalralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklgl
    saknygravyeclrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghyl
    natagtceemmkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhav
    idrqrnhgihfrvlakalrmsggdhlhsgtvvgklegerevtlgfvdlmrddyvekdrsr
    giyftqdwcsmpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaan
    rvaleactqarnegrdlareggdvirsackwspelaaacevwkeikfefdtidkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ir2W (W:)
    gagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtwttv
    wtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfgfka
    lralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklglsaknygrav
    yeclrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghylnatagtcee
    mmkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhavidrqrnhgi
    hfrvlakalrmsggdhlhsgtvvgklegerevtlgfvdlmrddyvekdrsrgiyftqdwc
    smpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaanrvaleactq
    arnegrdlareggdvirsackwspelaaacevwkeikfefdtidkl
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >1ir2X (X:)
    mvpqtetkagagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaae
    sstgtwttvwtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsi
    vgnvfgfkalralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklgl
    saknygravyeclrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghyl
    natagtceemmkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhav
    idrqrnhgihfrvlakalrmsggdhlhsgtvvgklegerevtlgfvdlmrddyvekdrsr
    giyftqdwcsmpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaan
    rvaleactqarnegrdlareggdvirsackwspelaaacevwkeikfefdtidkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ir2X (X:)
    gagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtwttv
    wtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfgfka
    lralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklglsaknygrav
    yeclrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghylnatagtcee
    mmkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhavidrqrnhgi
    hfrvlakalrmsggdhlhsgtvvgklegerevtlgfvdlmrddyvekdrsrgiyftqdwc
    smpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaanrvaleactq
    arnegrdlareggdvirsackwspelaaacevwkeikfefdtidkl
    

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >1ir2Y (Y:)
    mvpqtetkagagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaae
    sstgtwttvwtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsi
    vgnvfgfkalralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklgl
    saknygravyeclrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghyl
    natagtceemmkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhav
    idrqrnhgihfrvlakalrmsggdhlhsgtvvgklegerevtlgfvdlmrddyvekdrsr
    giyftqdwcsmpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaan
    rvaleactqarnegrdlareggdvirsackwspelaaacevwkeikfefdtidkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ir2Y (Y:)
    agfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtwttvw
    tdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfgfkal
    ralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklglsaknygravy
    eclrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghylnatagtceem
    mkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhavidrqrnhgih
    frvlakalrmsggdhlhsgtvvgklegerevtlgfvdlmrddyvekdrsrgiyftqdwcs
    mpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaanrvaleactqa
    rnegrdlareggdvirsackwspelaaacevwkeikfefdtidkl
    

  • Chain 'Z':
    Sequence, based on SEQRES records: (download)
    >1ir2Z (Z:)
    mvpqtetkagagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaae
    sstgtwttvwtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsi
    vgnvfgfkalralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklgl
    saknygravyeclrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghyl
    natagtceemmkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhav
    idrqrnhgihfrvlakalrmsggdhlhsgtvvgklegerevtlgfvdlmrddyvekdrsr
    giyftqdwcsmpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaan
    rvaleactqarnegrdlareggdvirsackwspelaaacevwkeikfefdtidkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ir2Z (Z:)
    gagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtwttv
    wtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfgfka
    lralrledlrippayvktfvgpphgiqverdklnkygrgllgctikpklglsaknygrav
    yeclrggldftkddenvnsqpfmrwrdrflfvaeaiykaqaetgevkghylnatagtcee
    mmkravcakelgvpiimhdyltggftantslaiycrdnglllhihramhavidrqrnhgi
    hfrvlakalrmsggdhlhsgtvvgklegerevtlgfvdlmrddyvekdrsrgiyftqdwc
    smpgvmpvasggihvwhmpalveifgddaclqfgggtlghpwgnapgaaanrvaleactq
    arnegrdlareggdvirsackwspelaaacevwkeikfefdtidkl