PDB entry 1iqw

View 1iqw on RCSB PDB site
Description: crystal structure of the fab fragment of the mouse anti-human fas antibody hfe7a
Deposited on 2001-08-10, released 2002-01-23
The last revision prior to the SCOP 1.65 freeze date was dated 2002-01-30, with a file datestamp of 2002-01-30.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.168
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1iqwH (H:)
    qvqlqqpgaelvkpgasvklsckasgytftsywmqwvkqrpgqglewigeidpsdsytny
    nqkfkgkatltvdtssstaymqlssltsedsavyycarnrdysnnwyfdvwgtgttvtvs
    sakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqs
    dlytlsssvtvpsstwpsqtvtcnvahpasstkvdkkivprdcgckpcic
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iqwH (H:)
    qvqlqqpgaelvkpgasvklsckasgytftsywmqwvkqrpgqglewigeidpsdsytny
    nqkfkgkatltvdtssstaymqlssltsedsavyycarnrdysnnwyfdvwgtgttvtvs
    sakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqs
    dlytlsssvtvpsstwpsqtvtcnvahpasstkvdkkivpr
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1iqwL (L:)
    divltqspaslavslgqratisckasqsvdydgdsymnwyqqkpgqppklliyaasnles
    giparfsgsgsgtdftlnihpveeedaatyycqqsnedprtfgggtkleikradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iqwL (L:)
    divltqspaslavslgqratisckasqsvdydgdsymnwyqqkpgqppklliyaasnles
    giparfsgsgsgtdftlnihpveeedaatyycqqsnedprtfgggtkleikradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhnsytceathktstspivksfnr