PDB entry 1iqw

View 1iqw on RCSB PDB site
Description:
Deposited on 2001-08-10, released 2002-01-23
The last revision prior to the SCOP 1.59 freeze date was dated 2002-01-30, with a file datestamp of 2002-01-30.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.168
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.59: d1iqwh1, d1iqwh2
  • Chain 'L':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.59: d1iqwl1, d1iqwl2

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iqwH (H:)
    qvqlqqpgaelvkpgasvklsckasgytftsywmqwvkqrpgqglewigeidpsdsytny
    nqkfkgkatltvdtssstaymqlssltsedsavyycarnrdysnnwyfdvwgtgttvtvs
    sakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqs
    dlytlsssvtvpsstwpsqtvtcnvahpasstkvdkkivpr
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iqwL (L:)
    divltqspaslavslgqratisckasqsvdydgdsymnwyqqkpgqppklliyaasnles
    giparfsgsgsgtdftlnihpveeedaatyycqqsnedprtfgggtkleikradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhnsytceathktstspivksfnr