PDB entry 1iqc

View 1iqc on RCSB PDB site
Description: Crystal structure of Di-Heme Peroxidase from Nitrosomonas europaea
Class: oxidoreductase
Keywords: Di-Heme Peroxidase, Nitrosomonas europaea, Proteobacteria, beta subdivision, Ammonia-oxidizing bacteria, OXIDOREDUCTASE
Deposited on 2001-07-20, released 2002-01-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.222
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: di-heme peroxidase
    Species: Nitrosomonas europaea [TaxId:915]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1iqca1, d1iqca2
  • Chain 'B':
    Compound: di-heme peroxidase
    Species: Nitrosomonas europaea [TaxId:915]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1iqcb1, d1iqcb2
  • Chain 'C':
    Compound: di-heme peroxidase
    Species: Nitrosomonas europaea [TaxId:915]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1iqcc1, d1iqcc2
  • Chain 'D':
    Compound: di-heme peroxidase
    Species: Nitrosomonas europaea [TaxId:915]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1iqcd1, d1iqcd2
  • Heterogens: CA, MG, HEM, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iqcA (A:)
    anepiqpikavtpenadmaelgkmlffdprlsksgfiscnschnlsmggtdnittsighk
    wqqgpinaptvlnssmnlaqfwdgrakdlkeqaagpianpkemastheiaekvvasmpqy
    rerfkkvfgsdevtidrittaiaqfeetlvtpgskfdkwlegdknalnqdelegynlfkg
    sgcvqchngpavggssyqkmgvfkpyetknpaagrmdvtgneadrnvfkvptlrnielty
    pyfhdggaatleqavetmgriqlnrefnkdevskivaflktltgdqpdfklpilppsnnd
    tprsqpye
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iqcB (B:)
    anepiqpikavtpenadmaelgkmlffdprlsksgfiscnschnlsmggtdnittsighk
    wqqgpinaptvlnssmnlaqfwdgrakdlkeqaagpianpkemastheiaekvvasmpqy
    rerfkkvfgsdevtidrittaiaqfeetlvtpgskfdkwlegdknalnqdelegynlfkg
    sgcvqchngpavggssyqkmgvfkpyetknpaagrmdvtgneadrnvfkvptlrnielty
    pyfhdggaatleqavetmgriqlnrefnkdevskivaflktltgdqpdfklpilppsnnd
    tprsqpye
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iqcC (C:)
    anepiqpikavtpenadmaelgkmlffdprlsksgfiscnschnlsmggtdnittsighk
    wqqgpinaptvlnssmnlaqfwdgrakdlkeqaagpianpkemastheiaekvvasmpqy
    rerfkkvfgsdevtidrittaiaqfeetlvtpgskfdkwlegdknalnqdelegynlfkg
    sgcvqchngpavggssyqkmgvfkpyetknpaagrmdvtgneadrnvfkvptlrnielty
    pyfhdggaatleqavetmgriqlnrefnkdevskivaflktltgdqpdfklpilppsnnd
    tprsqpye
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iqcD (D:)
    anepiqpikavtpenadmaelgkmlffdprlsksgfiscnschnlsmggtdnittsighk
    wqqgpinaptvlnssmnlaqfwdgrakdlkeqaagpianpkemastheiaekvvasmpqy
    rerfkkvfgsdevtidrittaiaqfeetlvtpgskfdkwlegdknalnqdelegynlfkg
    sgcvqchngpavggssyqkmgvfkpyetknpaagrmdvtgneadrnvfkvptlrnielty
    pyfhdggaatleqavetmgriqlnrefnkdevskivaflktltgdqpdfklpilppsnnd
    tprsqpye