PDB entry 1ipa

View 1ipa on RCSB PDB site
Description: crystal structure of RNA 2'-o ribose methyltransferase
Class: transferase
Keywords: deep trefoil knot, Rossmann fold, eL30-like fold, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, TRANSFERASE
Deposited on 2001-05-02, released 2002-07-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.226
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RNA 2'-o-ribose methyltransferase
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ipaa1, d1ipaa2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ipaA (A:)
    mritstanprikelarllerkhrdsqrrfliegareieralqagieleqalvwegglnpe
    eqqvyaalgrvgrlallevseavlkklsvrdnpaglialarmpertleeyrpspdalilv
    avglekpgnlgavlrsadaagaeavlvaggvdlyspqvirnstgvvfslrtlaasesevl
    dwikqhnlplvattphaealyweanlrppvaiavgpeheglraawleaaqtqvripmqgq
    adslnvsvsaalllyealrqrllrdrltkthstl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ipaA (A:)
    mritstanprikelarllerkhrdsqrrfliegareieralqagieleqalvwegglnpe
    eqqvyaallallevseavlkklsvrdnpaglialarmpertleeyrpspdalilvavgle
    kpgnlgavlrsadaagaeavlvaggvdlyspqvirnstgvvfslrtlaasesevldwikq
    hnlplvattphaealyweanlrppvaiavgpeheglraawleaaqtqvripmqgqadsln
    vsvsaalllyealrqrll