PDB entry 1ip2

View 1ip2 on RCSB PDB site
Description: g48a human lysozyme
Class: hydrolase
Keywords: Glycosidase, Bacteriolytic enzyme
Deposited on 2001-04-20, released 2001-11-14
The last revision prior to the SCOP 1.73 freeze date was dated 2003-01-14, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.179
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lysozyme C
    Species: HOMO SAPIENS
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61626 (0-129)
      • engineered (47)
    Domains in SCOP 1.73: d1ip2a_
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ip2A (A:)
    kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynaadrstdygifqin
    srywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
    vrqyvqgcgv