PDB entry 1ip0

View 1ip0 on RCSB PDB site
Description: nmr structure of human betacellulin-2
Class: hormone/growth factor
Keywords: EGF-like fold
Deposited on 2001-04-19, released 2002-07-31
The last revision prior to the SCOP 1.73 freeze date was dated 2003-01-14, with a file datestamp of 2007-06-04.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Betacellulin
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1ip0a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ip0A (A:)
    rkghfsrcpkqykhycikgrcrfvvaeqtpscvcdegyigarcervdlfy