PDB entry 1iox

View 1iox on RCSB PDB site
Description: NMR Structure of human Betacellulin-2
Class: hormone/growth factor
Keywords: EGF-like fold, HORMONE/GROWTH FACTOR COMPLEX
Deposited on 2001-04-18, released 2002-07-24
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Betacellulin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1ioxa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ioxA (A:)
    rkghfsrcpkqykhycikgrcrfvvaeqtpscvcdegyigarcervdlfy