PDB entry 1iox

View 1iox on RCSB PDB site
Description: NMR Structure of human Betacellulin-2
Class: hormone/growth factor
Keywords: EGF-like fold
Deposited on 2001-04-18, released 2002-07-24
The last revision prior to the SCOP 1.73 freeze date was dated 2003-01-14, with a file datestamp of 2007-06-04.
Experiment type: NMR40
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Betacellulin
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1ioxa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ioxA (A:)
    rkghfsrcpkqykhycikgrcrfvvaeqtpscvcdegyigarcervdlfy