PDB entry 1ios

View 1ios on RCSB PDB site
Description: stabilization of hen egg white lysozyme by a cavity-filling mutation
Class: hydrolase
Keywords: hydrolase, Glycosidase, Bacteriolytic enzyme
Deposited on 2001-03-28, released 2001-04-11
The last revision prior to the SCOP 1.75 freeze date was dated 2003-01-14, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.76 Å
R-factor: 0.166
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lysozyme C
    Species: GALLUS GALLUS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00698 (0-128)
      • engineered (11)
    Domains in SCOP 1.75: d1iosa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iosA (A:)
    kvfgrcelaaafkrhgldnyrgyslgnwvcaakfesnfntqatnrntdgstdygilqins
    rwwcndgrtpgsrnlcnipcsallssditasvncakkivsdgngmnawvawrnrckgtdv
    qawirgcrl