PDB entry 1ioq

View 1ioq on RCSB PDB site
Description: stabilization of hen egg white lysozyme by a cavity-filling mutation
Deposited on 2001-03-28, released 2001-04-11
The last revision prior to the SCOP 1.59 freeze date was dated 2001-04-11, with a file datestamp of 2001-04-11.
Experiment type: XRAY
Resolution: 1.79 Å
R-factor: 0.168
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1ioqa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ioqA (A:)
kvfgrcelaaafkrhgldnyrgyslgnwvcaakfesnfntqatnrntdgstdygifqins
rwwcndgrtpgsrnlcnipcsallssditasvncakkivsdgngmnawvawrnrckgtdv
qawirgcrl