PDB entry 1iod

View 1iod on RCSB PDB site
Description: crystal structure of the complex between the coagulation factor x binding protein from snake venom and the gla domain of factor x
Class: hydrolase/hydrolase inhibitor
Keywords: calcium bridging, domain swapping
Deposited on 2001-02-27, released 2001-06-27
The last revision prior to the SCOP 1.75 freeze date was dated 2001-06-27, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.201
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: coagulation factor x binding protein
    Species: Agkistrodon acutus
    Domains in SCOP 1.75: d1ioda_
  • Chain 'B':
    Compound: coagulation factor x binding protein
    Species: Agkistrodon acutus
    Domains in SCOP 1.75: d1iodb_
  • Chain 'G':
    Compound: coagulation factor x gla domain
    Species: BOS TAURUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1iodg_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1iodA (A:)
dcssgwssyeghcykvfkqsktwadaesfctkqvngghlvsiessgeadfvgqliaqkik
sakihvwiglraqnkekqcsiewsdgssisyenwieeeskkclgvhietgfhkwenfyce
qqdpfvcea

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1iodB (B:)
dcpsdwssyeghcykpfnepknwadaenfctqqhtgshlvsfqsteeadfvvklafqtfd
ygifwmglskiwnqcnwqwsnaamlkytdwaeesycvyfkstnnkwrsitcrmianfvce
fqa

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1iodG (G:)
ansfleevkqgnlerecleeacsleearevfedaeqtdefwsky