PDB entry 1iod

View 1iod on RCSB PDB site
Description: crystal structure of the complex between the coagulation factor x binding protein from snake venom and the gla domain of factor x
Deposited on 2001-02-27, released 2001-06-27
The last revision prior to the SCOP 1.63 freeze date was dated 2001-06-27, with a file datestamp of 2001-06-27.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.201
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1ioda_
  • Chain 'B':
    Domains in SCOP 1.63: d1iodb_
  • Chain 'G':
    Domains in SCOP 1.63: d1iodg_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iodA (A:)
    dcssgwssyeghcykvfkqsktwadaesfctkqvngghlvsiessgeadfvgqliaqkik
    sakihvwiglraqnkekqcsiewsdgssisyenwieeeskkclgvhietgfhkwenfyce
    qqdpfvcea
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iodB (B:)
    dcpsdwssyeghcykpfnepknwadaenfctqqhtgshlvsfqsteeadfvvklafqtfd
    ygifwmglskiwnqcnwqwsnaamlkytdwaeesycvyfkstnnkwrsitcrmianfvce
    fqa
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iodG (G:)
    ansfleevkqgnlerecleeacsleearevfedaeqtdefwsky