PDB entry 1ioc

View 1ioc on RCSB PDB site
Description: crystal structure of mutant human lysozyme, eaea-i56t
Class: hydrolase
Keywords: amyloid, mutant, human lysozyme, stability
Deposited on 2001-02-27, released 2002-10-09
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.21
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lysozyme C
    Species: HOMO SAPIENS
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61626 (4-133)
      • cloning artifact (1-3)
      • engineered (59)
    Domains in SCOP 1.73: d1ioca_
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1iocA (A:)
    eaeakvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygt
    fqinsrywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrc
    qnrdvrqyvqgcgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iocA (A:)
    aeakvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygtf
    qinsrywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcq
    nrdvrqyvqgcgv