PDB entry 1ioc

View 1ioc on RCSB PDB site
Description:
Deposited on 2001-02-27, released 2002-10-09
The last revision prior to the SCOP 1.71 freeze date was dated 2002-10-09, with a file datestamp of 2002-10-09.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.21
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1ioca_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1iocA (A:)
    eaeakvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygt
    fqinsrywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrc
    qnrdvrqyvqgcgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iocA (A:)
    aeakvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygtf
    qinsrywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcq
    nrdvrqyvqgcgv