PDB entry 1io6

View 1io6 on RCSB PDB site
Description: growth factor receptor-bound protein 2 (grb2) c-terminal sh3 domain complexed with a ligand peptide (nmr, minimized mean structure)
Class: signaling protein
Keywords: signal transduction, sh3 domain, proline-rich peptide, complex (sh3 domain/peptide), signaling protein
Deposited on 2001-01-25, released 2001-02-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Growth factor receptor-bound protein 2
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P62993 (2-58)
    • cloning artifact (0-1)
  Domains in SCOPe 2.07: d1io6a1, d1io6a2
• Chain 'B':
  Compound: a ligand peptide
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • PDB 1IO6 (0-9)

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1io6A (A:)
  gstyvqalfdfdpqedgelgfrrgdfihvmdnsdpnwwkgachgqtgmfprnyvtpvnr
  

  
  
• Chain 'B':
  No sequence available.