PDB entry 1io3

View 1io3 on RCSB PDB site
Description: crystal structure of ferricytochrome c2 from rhodopseudomonas viridis
Class: electron transport
Keywords: heme protein
Deposited on 2001-01-06, released 2001-04-18
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.208
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c2
    Species: Rhodopseudomonas viridis
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1io3a_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1io3A (A:)
    qdaasgeqvfkqclvchsigpgaknkvgpvlnglfgrhsgtiegfaysdanknsgitwte
    evfreyirdpkakipgtkmifagvkdeqkvsdliayikqfnadgskk