PDB entry 1inq

View 1inq on RCSB PDB site
Description: Structure of Minor Histocompatibility Antigen peptide, H13a, complexed to H2-Db
Class: immune system
Keywords: minor histocompatibility antigen, MHC complex, IMMUNE SYSTEM
Deposited on 2001-05-14, released 2002-03-20
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.208
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: H-2 class I histocompatibility antigen, D-B alpha chain
  Species: Mus musculus [TaxId:10090]
  Gene: H2-Db
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01899 (0-274)
  Domains in SCOPe 2.05: d1inqa1, d1inqa2
• Chain 'B':
  Compound: beta-2 microglobulin
  Species: Mus musculus [TaxId:10090]
  Gene: B2M
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01887 (0-98)
  Domains in SCOPe 2.05: d1inqb_
• Chain 'C':
  Compound: MHC Class I H13a minor histocompatibility peptide
  Species: synthetic, synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9D8V0 (0-8)
• Heterogens: DMS, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1inqA (A:)
  gphsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeyw
  eretqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayeg
  rdyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatll
  rtdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgt
  fqkwasvvvplgkeqnytcrvyheglpepltlrwe
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1inqB (B:)
  iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
  sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
  

  
  
• Chain 'C':
  No sequence available.