PDB entry 1ine

View 1ine on RCSB PDB site
Description: how the anti-(metal chelate) antibody cha255 is specific for the metal ion of its antigen: x-ray structures for two fab'(slash)hapten complexes with different metals in the chelate
Deposited on 1993-06-14, released 1993-10-31
The last revision prior to the SCOP 1.55 freeze date was dated 1995-01-15, with a file datestamp of 1995-01-19.
Experiment type: -
Resolution: 2.8 Å
R-factor: 0.176
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ineH (H:)
    evtlvesggdsvkpggslklscaasgftlsgetmswvrqtpekrlewvattlsgggftfy
    sasvkgrftisrdnaqnnlylqlnslrsedtalyfcashrfvhwghgtlvtvsakttpps
    vyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlesdlytlsss
    vtvpssprpsetvtcnvahpasstkvdkkivpr
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ineL (L:)
    avvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtnnrapgvp
    arfsgsligdkaaltitgaqtedearyfcalwysnlwvfgggtkltvlgqpksspsvtlf
    ppsseeletnkatlvctiidfypgvvtvdwkvdgtpvtqgmettqpskqsnnkymassyl
    tltarewerhssyscqvtheghtvekslsra