PDB entry 1imo

View 1imo on RCSB PDB site
Description: nmr structure of human DNA ligase iiialpha brct domain
Class: ligase
Keywords: parallel beta sheet, LIGASE
Deposited on 2001-05-11, released 2001-05-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-19.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: DNA ligase III
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P49916 (0-87)
    • cloning artifact (0-1)
  Domains in SCOPe 2.07: d1imoa1, d1imoa2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1imoA (A:)
  gsadetlcqtkvlldiftgvrlylppstpdfsrlrryfvafdgdlvqefdmtsathvlgs
  rdknpaaqqvspewiwacirkrrlvapc