PDB entry 1imh

View 1imh on RCSB PDB site
Description: tonebp/dna complex
Deposited on 2001-05-10, released 2002-02-01
The last revision prior to the SCOP 1.63 freeze date was dated 2002-02-01, with a file datestamp of 2002-02-01.
Experiment type: XRAY
Resolution: 2.86 Å
R-factor: 0.244
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1imhC (C:)
    kkspmlcgqypvksegkelkivvqpetqhraryltegsrgsvkdrtqqgfptvkleghne
    pvvlqvfvgndsgrvkphgfyqacrvtgrnttpckevdiegttvievgldpsnnmtlavd
    cvgilklrnadvearigiagskkkstrarlvfrvnimrkdgstltlqtpsspilctqpag
    vpeilkkslhscsvkgeeevfligknflkgtkvifqenvsdenswkseaeidmelfhqnh
    livkvppyhdqhitlpvsvgiyvvtnagrshdvqpftytpd
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1imhD (D:)
    kkspmlcgqypvksegkelkivvqpetqhraryltegsrgsvkdrtqqgfptvkleghne
    pvvlqvfvgndsgrvkphgfyqacrvtgrnttpckevdiegttvievgldpsnnmtlavd
    cvgilklrnadvearigiagskkkstrarlvfrvnimrkdgstltlqtpsspilctqpag
    vpeilkkslhscsvkgeeevfligknflkgtkvifqenvsdenswkseaeidmelfhqnh
    livkvppyhdqhitlpvsvgiyvvtnagrshdvqpftytpd