PDB entry 1im4

View 1im4 on RCSB PDB site
Description: Crystal Structure of a DinB Homolog (DBH) Lesion Bypass DNA Polymerase Catalytic Fragment from Sulfolobus solfataricus
Deposited on 2001-05-09, released 2001-09-12
The last revision prior to the SCOP 1.67 freeze date was dated 2001-09-12, with a file datestamp of 2001-09-12.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.227
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1im4a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1im4A (A:)
    hhhhhhivifvdfdyffaqveevlnpqykgkplvvcvysgrtktsgavatanyearklgv
    kagmpiikamqiapsaiyvpmrkpiyeafsnrimnllnkhadkievasideayldvtnkv
    egnfengielarkikqeilekekitvtvgvapnkilakiiadkskpnglgvirptevqdf
    lneldideipgigsvlarrlnelgiqklrdilsknynelek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1im4A (A:)
    hhhhhivifvdfdyffaqveevlnpqykgkplvvcvystsgavatanyearklgvkagmp
    iikamqiapsaiyvpmrkpiyeafsnrimnllnkhadkievasideayldvtnkvegnfe
    ngielarkikqeilekekitvtvgvapnkilakiiadkskpnglgvirptevqdflneld
    ideipgigsvlarrlnelgiqklrd