PDB entry 1ily

View 1ily on RCSB PDB site
Description: Solution Structure of Ribosomal Protein L18 of Thermus thermophilus
Class: RNA binding protein
Keywords: mixed alpha/beta
Deposited on 2001-05-09, released 2002-05-01
The last revision prior to the SCOP 1.73 freeze date was dated 2002-05-01, with a file datestamp of 2007-06-04.
Experiment type: NMR27
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribosomal protein l18
    Species: Thermus thermophilus
    Gene: RL18
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1ilya_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ilyA (A:)
    rlrlsvfrslkhiyaqiiddekgvtlvsasslalklkgnktevarqvgralaekalalgi
    kqvafdrgpykyhgrvkalaegaregglef