PDB entry 1ilk

View 1ilk on RCSB PDB site
Description: interleukin-10 crystal structure reveals the functional dimer with an unexpected topological similarity to interferon gamma
Deposited on 1995-04-21, released 1995-07-10
The last revision prior to the SCOP 1.65 freeze date was dated 1995-07-10, with a file datestamp of 1995-07-11.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.156
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.65: d1ilk__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ilk_ (-)
  nscthfpgnlpnmlrdlrdafsrvktffqmkdqldnlllkeslledfkgylgcqalsemi
  qfyleevmpqaenqdpdikahvnslgenlktlrlrlrrchrflpcenkskaveqvknafn
  klqekgiykamsefdifinyieaymtmkirn