PDB entry 1iku

View 1iku on RCSB PDB site
Description: myristoylated recoverin in the calcium-free state, nmr, 22 structures
Deposited on 1996-01-18, released 1996-07-11
The last revision prior to the SCOP 1.55 freeze date was dated 1996-07-11, with a file datestamp of 1996-07-11.
Experiment type: NMR22
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1iku__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iku_ (-)
    gnsksgalskeileelqlntkfteeelsswyqsflkecpsgritrqefqtiyskffpead
    pkayaqhvfrsfdansdgtldfkeyvialhmtsagktnqklewafslydvdgngtiskne
    vleivtaifkmispedtkhlpedentpekraekiwgffgkkdddkltekefiegtlanke
    ilrliqfe