PDB entry 1ikn

View 1ikn on RCSB PDB site
Description: ikappabalpha/nf-kappab complex
Deposited on 1998-11-13, released 1999-04-12
The last revision prior to the SCOP 1.61 freeze date was dated 1999-04-12, with a file datestamp of 1999-04-13.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.223
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1iknA (A:)
    pyveiieqpkqrgmrfrykcegrsagsipgerstdttkthptikingytgpgtvrislvt
    kdpphrphphelvgkdcrdgyyeadlcpdrsihsfqnlgiqcvkkrdleqaisqriqtnn
    npfhvpieeqrgdydlnavrlcfqvtvrdpagrpllltpvlshpifdnrapntaelkicr
    vnrnsgsclggdeifllcdkvqkedievyftgpgweargsfsqadvhrqvaivfrtppya
    dpslqapvrvsmqlrrpsdrelsepmefqylpdtddrhrieekrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iknA (A:)
    pyveiieqpkqrgmrfrykcegrsagsipgerstdttkthptikingytgpgtvrislvt
    kdpphrphphelvgkdcrdgyyeadlcpdrsihsfqnlgiqcvkkrdleqaisqriqtnn
    npfhvpieeqrgdydlnavrlcfqvtvrdpagrpllltpvlshpifdnrataelkicrvn
    rnsgsclggdeifllcdkvqkedievyftgpgweargsfsqadvhrqvaivfrtppyadp
    slqapvrvsmqlrrpsdrelsepmefqylpdtddrhrieekrk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1iknC (C:)
    asnlkivrmdrtagcvtggeeiyllcdkvqkddiqirfyeeeenggvwegfgdfsptdvh
    rqfaivfktpkykdvnitkpasvfvqlrrksdletsepkpflyypeikdkeev
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1iknD (D:)
    dgdsflhlaiiheekaltmevirqvkgdlaflnfqnnlqqtplhlavitnqpeiaeallg
    agcdpelrdfrgntplhlaceqgclasvgvltqscttphlhsilkatnynghtclhlasi
    hgylgivellvslgadvnaqepcngrtalhlavdlqnpdlvslllkcgadvnrvtyqgys
    pyqltwgrpstriqqqlgqltlenlqmlpesedeesydtes
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iknD (D:)
    dgdsflhlaiiheekaltmevirlaflnfqnnlqqtplhlavitnqpeiaeallgagcdp
    elrdfrgntplhlaceqgclasvgvltqscttphlhsilkatnynghtclhlasihgylg
    ivellvslgadvnaqepcngrtalhlavdlqnpdlvslllkcgadvnrvtyqgyspyqlt
    wgrpstriqqqlgqltlenlqmlpesedeesydtes